KEGG   Brucella canis Oliveri: BCOUA_I1199Help
Entry
BCOUA_I1199       CDS       T03030                                 

Definition
(GenBank) unnamed protein product
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bol  Brucella canis Oliveri
Pathway
bol00020  Citrate cycle (TCA cycle)
bol00480  Glutathione metabolism
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01120  Microbial metabolism in diverse environments
bol01130  Biosynthesis of antibiotics
bol01200  Carbon metabolism
bol01210  2-Oxocarboxylic acid metabolism
bol01230  Biosynthesis of amino acids
Module
bol_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bol_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCOUA_I1199
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCOUA_I1199
Enzymes [BR:bol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCOUA_I1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: CDL76593
Position
I:1178025..1179239
Genome map
AA seq 404 aa AA seqDB search
MAKIKVANPVVELDGDEMTRIIWQFIKDKLIHPYLDIDLKYYDLSVENRDATNDQVTIDA
ANAIKEYGVGVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGVIFREPIICKNVPRL
VPGWTQPIIVGRHAFGDQYRATDFKFPGKGTLTIKFVGEDGQTIEHEVYQAPSAGVAMAM
YNLDESIREFARASFNYGLQRGYPVYLSTKNTILKAYDGRFKDIFQEVFDAEFKSKFEEK
KIWYEHRLIDDMVASALKWSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLMTPDGKT
VEAEAAHGTVTRHYRQYQKGEETSTNSIASIFAWTRGLAHRAKLDNNADLKKFAETLEKV
CVDTVESGFMTKDLALLIGPDQPWLSTTGFLDKIDENLQKAMAA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcaaggttgcaaacccggtcgtcgagctcgacggcgacgagatgacccgc
attatctggcagttcatcaaggacaagcttatccatccctatctcgacatcgacctgaaa
tactacgatctttcggtcgagaaccgcgatgcgaccaatgatcaggtcacgatcgatgca
gccaatgccatcaaggaatatggcgtgggcgtaaaatgcgcgaccatcacgcccgacgaa
gcgcgcgtggaagaattcaagctgaagaaaatgtggaagtcgcccaacggcaccatccgc
aatatcctcggcggcgtgatcttccgcgagccgatcatctgcaagaacgtgccgcgcctc
gtgccgggctggacccagccgatcatcgtcggccgccatgctttcggcgaccagtaccgc
gcgactgacttcaagttccccggcaagggcacactgacgatcaagttcgtcggtgaagat
ggccagaccatcgaacatgaagtctatcaggccccttcggctggcgtggccatggccatg
tataatctggacgaatcgatccgcgaattcgcacgcgcttccttcaattacggcttgcag
cgcggctatccggtctatctctccacgaagaacaccatcctcaaggcctatgatggccgc
ttcaaggacatcttccaggaagtcttcgacgccgaattcaagtcgaagtttgaagaaaag
aagatctggtacgaacaccgcctcatcgacgacatggtcgcctcggcgctcaagtggtcg
ggcggctatgtctgggcctgtaagaactatgatggcgacgtgcagtcggatatcgtcgcg
cagggcttcggctcgctcggcctgatgacctcggttctgatgacgccggatggcaagacg
gtggaagcggaagccgcccacggcaccgtaacccgccactatcgccagtatcagaagggc
gaggaaacctcgaccaactccatcgcttcgatcttcgcatggacccgcggtctggcgcat
cgcgccaagctcgacaacaatgccgatctgaagaagttcgccgaaacgctggaaaaggtc
tgcgtggacaccgttgaaagcggcttcatgaccaaggatctggcgctcctcatcggcccg
gatcagccttggctctcgaccaccggcttcctcgacaagatcgacgaaaatcttcagaaa
gccatggctgcctga

DBGET integrated database retrieval system