KEGG   Brucella canis Oliveri: BCOUA_I1387Help
Entry
BCOUA_I1387       CDS       T03030                                 

Definition
(GenBank) unnamed protein product
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
bol  Brucella canis Oliveri
Brite
KEGG Orthology (KO) [BR:bol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCOUA_I1387
Enzymes [BR:bol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BCOUA_I1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 Viral_helicase1 PIF1 AAA_16 AAA_33 UvrD_C ATPase_2 TsaE AAA_22 AAA_28 AAA TniB AAA_18 AAA_11 SH3_13 AAA_5 NB-ARC AAA_13 PhoH
Motif
Other DBs
NCBI-ProteinID: CDL76773
Position
I:complement(1345073..1346194)
Genome map
AA seq 373 aa AA seqDB search
MQFSPEQDQALKAVGQWLKAGRSPIFRLFGYAGTGKTTLARYFAEHVDGEVQFAAFTGKA
AQVLRSKGASNARTLHSLIYRPRGEEAIEDETTGKTSIAPTFSLNRQSPVAKAAMIVVDE
CSMVDEALGRDLMSFGTPILVLGDPGQLPPISGGGFFTEHEPDYLLTEIHRQARDNPIIR
MALDVREGRELSYGDYGAAKVIGKSEVNQDIVLAADQVLVGTNRTRRRYNQRLRELKGFT
ADYPQAGDKLVCLRNDPTKGLLNGSLWKVMTSSKETVKPGINLLVSPEDEDRGVAKIKLL
KAQFEDPDTEIPWQTKKRFDDFDYGYALTVHKAQGSQWDQVVLFDESFAFRDTRERWLYT
AITRAAERLIIVK
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcagttttcacccgaacaggatcaggcgctgaaagcggtcggccaatggctcaaggcc
gggcgcagccccatcttcaggctctttggctatgccggcacgggcaagacgacgcttgcg
cgctattttgccgagcatgtggatggtgaggtgcagtttgcagccttcaccggcaaggcg
gcgcaggttctccgttccaagggcgccagcaatgcccgcacgcttcattccctgatttat
cgcccgcgcggtgaagaggcgattgaggacgagacgacaggcaagacatccattgcgcca
accttttcgctcaaccggcaaagcccggttgcgaaagccgccatgatcgtggtcgatgaa
tgttcgatggtggatgaggcgctgggacgggacctgatgagtttcggcacgccaattctc
gttctgggggatccgggccaattgccgccgatttccggcggcgggttcttcaccgagcat
gagccggattatctcctgaccgaaattcatcgtcaggcacgcgacaatccaatcatccgc
atggcgctggatgtgcgcgaaggccgggaactgtcctatggcgattatggcgcggcaaag
gtgatcggcaaaagcgaggtcaatcaggatatcgttctggccgcagatcaggtgcttgtg
ggcaccaaccgcaccaggcggcgctataaccagcgcctgcgggagctgaaaggttttacg
gccgattatccgcaggcgggtgacaagctcgtctgcctgcgcaacgatccgaccaagggg
ctgctcaacggctcgctctggaaggtgatgacttcttccaaggaaaccgtgaagcccggc
atcaatcttctggtctcgccggaggatgaggatcgcggcgttgccaagatcaagcttctc
aaggcgcagttcgaggacccggacaccgaaattccgtggcagaccaagaaacgttttgat
gattttgattatggctatgcgctgaccgtccataaggcgcagggttcgcaatgggatcag
gtcgttctgttcgacgaaagcttcgcctttcgcgatacgcgtgaacgctggctctatacg
gccattacgcgcgcggcagaacgcctcatcatcgtgaagtaa

DBGET integrated database retrieval system