KEGG   Brucella canis Oliveri: BCOUA_II0111Help
Entry
BCOUA_II0111      CDS       T03030                                 

Gene name
gnd
Definition
(GenBank) gnd
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bol  Brucella canis Oliveri
Pathway
bol00030  Pentose phosphate pathway
bol00480  Glutathione metabolism
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01120  Microbial metabolism in diverse environments
bol01130  Biosynthesis of antibiotics
bol01200  Carbon metabolism
Module
bol_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bol_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCOUA_II0111 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCOUA_II0111 (gnd)
Enzymes [BR:bol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BCOUA_II0111 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BCOUA_II0111 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N ApbA Sacchrp_dh_NADP F420_oxidored Shikimate_DH NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: CDL77665
Position
II:108366..109775
Genome map
AA seq 469 aa AA seqDB search
MEKADIGMVGLGVMGSNLALNIAEKGYTVAVYDRDEPVLKAFIEKAGRLRDKIIPCPTFE
ELAANIRKPRPIIFLIKAGAPVDTETTRLKAFLEKGDIMIDAGNSDYRDTVRRLKALGPN
DPTFVGMGVSGGVEGARHGPSMMVGGTEQAYERIAPILLAVAAKYQGEPCCALVGPDGAG
HFVKTIHNGIEYADMQMIAEIYGILRDGLGLSAPAIGDVFEKWNEGPLNSYLIEITAKVL
KSTDPETGKAMVDMILDEAGQKGTGRWAAIEAQILGVPATGIEAAVAARSLSSMKGEREE
AAKAYKSGARTLDIANQTRFLSDLEQGLLAGKIAAYAQGFAVMEAASREHGWNIPLATTA
RIWRAGCIIRSQLLDDIAQAFEGNESRNLLMAPAFVPRMETSVKSLRQIVAQAALASLPL
PALGSALSYFDSYTQALGTANLIQGQRDFFGSHGFKRIDKEGDFHGPWG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcagatatcggaatggtcggccttggcgtcatgggctccaacctggcgctg
aacatagccgagaagggctacaccgtggccgtctatgaccgtgatgagcctgtgctgaaa
gctttcatcgaaaaggctggccggctgcgcgacaagatcattccctgcccgacctttgag
gaactggccgcgaatatccgcaagccccgtccgatcatctttctcatcaaggccggtgcg
ccagtcgataccgagaccacccgcctcaaggcattccttgagaagggcgatatcatgatc
gatgcaggcaattccgattatcgcgatacggtgcgccgcctgaaggctcttggccccaat
gatccgacctttgtcggcatgggcgtttcgggtggggtggaaggcgcgcgccatggtccg
tcgatgatggtcggcggcacggagcaggcctatgagcgcatcgcgccgatcctgcttgct
gtcgccgccaaatatcagggcgagccctgctgtgcgctggtcggcccggatggcgcgggt
catttcgtcaaaaccatccataacggtattgaatatgccgatatgcagatgatcgccgaa
atttacggcattctgcgcgatggccttggcctttcagctccggccatcggcgatgtgttc
gagaagtggaacgaaggtccgctcaattcctatctgattgaaatcaccgccaaggttctc
aagtccaccgacccggaaaccggcaaggcgatggtcgatatgatccttgatgaagccggc
cagaagggtacaggccgctgggctgccattgaggcgcagatactgggcgttccggccacg
ggcatcgaagccgcggttgccgcccgttcgctgtcctccatgaagggcgagcgggaagag
gccgccaaggcgtataaatccggtgcacgcacacttgatattgccaaccagacccgcttc
ctttccgatctggaacagggcttgctggcgggcaagatcgccgcttatgcgcaaggcttt
gcagtgatggaagccgcctcaagggagcatggctggaacattccgcttgccaccacggcg
cgcatctggcgcgcgggctgcatcatccgctcgcagcttctggatgatattgcgcaggct
tttgaaggcaatgaaagccgtaacctgctcatggccccggccttcgtgccgcgcatggaa
acatctgtgaaaagccttcgccagattgtcgcgcaggccgcccttgccagcctgccgctg
cccgcgctcggctctgcgctcagctatttcgacagctatacgcaggcgcttggtacggcc
aatctcattcagggccagcgcgatttcttcggctcgcacggcttcaagcgcattgacaag
gagggggatttccacggcccctggggctga

DBGET integrated database retrieval system