KEGG   Brucella canis Oliveri: BCOUA_II0448Help
Entry
BCOUA_II0448      CDS       T03030                                 

Gene name
phbA-2
Definition
(GenBank) phbA-2
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bol  Brucella canis Oliveri
Pathway
bol00071  Fatty acid degradation
bol00072  Synthesis and degradation of ketone bodies
bol00280  Valine, leucine and isoleucine degradation
bol00310  Lysine degradation
bol00362  Benzoate degradation
bol00380  Tryptophan metabolism
bol00620  Pyruvate metabolism
bol00630  Glyoxylate and dicarboxylate metabolism
bol00640  Propanoate metabolism
bol00650  Butanoate metabolism
bol00900  Terpenoid backbone biosynthesis
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01120  Microbial metabolism in diverse environments
bol01130  Biosynthesis of antibiotics
bol01200  Carbon metabolism
bol01212  Fatty acid metabolism
bol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCOUA_II0448 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    BCOUA_II0448 (phbA-2)
   00640 Propanoate metabolism
    BCOUA_II0448 (phbA-2)
   00650 Butanoate metabolism
    BCOUA_II0448 (phbA-2)
  Lipid metabolism
   00071 Fatty acid degradation
    BCOUA_II0448 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    BCOUA_II0448 (phbA-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCOUA_II0448 (phbA-2)
   00310 Lysine degradation
    BCOUA_II0448 (phbA-2)
   00380 Tryptophan metabolism
    BCOUA_II0448 (phbA-2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCOUA_II0448 (phbA-2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCOUA_II0448 (phbA-2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BCOUA_II0448 (phbA-2)
Enzymes [BR:bol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCOUA_II0448 (phbA-2)
Exosome [BR:bol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCOUA_II0448 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDL77991
Position
II:complement(435964..437154)
Genome map
AA seq 396 aa AA seqDB search
MSKSDPIVIVGASRTPMGGFQGDFTNAQATDLGASAIGGALAGAGLAPEAVEEVIMGCVL
PAGQGQAPARQASLKAGLPLGTGATTVNKMCGSGMKAAMLAHDLILAGSADVIVAGGMES
MTNAPYLLPKARGGYRMGHGQVLDHMFLDGLEDAYDKGRLMGTFAEDCAEAYQFTREAQD
AFAISSLTRAQNAIKDGLFAAEITPVKVKSGRAEVEVTIDEQPGKAKLDKIPTLRPAFRE
GGTVTAANSSSISDGAAALLLMRASEAEKRGLTPHAVITGHATYADKPNLFSTAPIGAIR
KLSEKTGWDLKDVDLFEINEAFAVVAMAAMRDLDLPHDKVNIHGGACALGHPIGASGARI
LVTLLAALETHGLKRGIAGICLGGGEATAMGIERII
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagagcgatcctattgtcatcgtcggtgcttcgcgcacccccatgggcggtttt
cagggtgacttcacaaatgcgcaggcaaccgaccttggcgcttccgccatcggcggcgcg
cttgccggtgcaggccttgccccggaagccgtcgaggaggttatcatgggctgtgtcctg
cctgctggtcagggtcaggcgcctgcgcgtcaggcctcgctcaaggccgggctgccgctt
ggcaccggtgccacgaccgtcaacaagatgtgcggctcgggcatgaaggccgcgatgctt
gcccatgacctcatccttgccggttccgccgatgtcatcgtcgcgggcggcatggaaagc
atgacaaatgccccctatcttctgcccaaggcgcgcgggggctatcgcatgggccatgga
caggtgctcgaccatatgttcctcgatgggctggaagatgcctatgacaaggggcgcctg
atgggcacgtttgcggaagattgcgccgaggcctaccagttcacgcgcgaggcgcaggac
gcatttgcgatatcctccctgacccgcgcgcagaacgcgatcaaggatggtctttttgcg
gcggaaatcacgccggtcaaggtcaagtccggccgcgccgaggtggaagttaccattgac
gagcagccgggcaaggcaaagctggacaagatccccacgctgcgccccgccttccgcgaa
ggcggcacggtaacggcggccaattcctcttccatttccgatggcgcggcagcacttctg
ctcatgcgcgcatcggaggcagaaaaacgtggcctcaccccgcacgcggtcatcaccggc
cacgcaacctatgccgacaagccaaatctcttctccacggcccccattggcgcgatccgc
aaactgtctgaaaagactggctgggatttgaaggatgtcgatctcttcgagatcaatgaa
gcctttgccgttgttgccatggccgccatgcgcgatctcgacctgccgcacgacaaggtc
aatattcatggcggcgcctgtgcacttggccaccccatcggcgcatcgggcgcacgtatt
ctcgtaaccctgctggcggcacttgaaacacatggcctgaagcgcggcatcgcgggcatc
tgccttggcggcggcgaggcaaccgcaatgggtatcgaaaggatcatctga

DBGET integrated database retrieval system