KEGG   Brucella canis Oliveri: BCOUA_II0681Help
Entry
BCOUA_II0681      CDS       T03030                                 

Definition
(GenBank) unnamed protein product
  KO
K01469  5-oxoprolinase (ATP-hydrolysing) [EC:3.5.2.9]
Organism
bol  Brucella canis Oliveri
Pathway
bol00480  Glutathione metabolism
bol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCOUA_II0681
Enzymes [BR:bol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.9  5-oxoprolinase (ATP-hydrolysing)
     BCOUA_II0681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydantoinase_B Hydantoinase_A Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: CDL78217
Position
II:657373..660969
Genome map
AA seq 1198 aa AA seqDB search
MSAAWDFWIDRGGTFTDVIGRDPEGHLHARKVLSENPSAYKDAAVHGIRLHLGLKTGEPV
PAGIIGEVRMGTTVATNALLERKGERLALVTTKGFRDALKIGYQERKNIFATEIIKPEAL
YDKVVELDERVRADGTVEKALALAEAEKALRALKAEGYKSIAIALMRAYKFPAHEIEIAR
IARDLGFEQVSVSHEVSPLIKLVGRSDTTVVDAYLSPVLRRYVAQVSDELDVERTGARVM
FMMSSGGLTAADLFQGKDAILSGPAGGVVGLARTGETAGFGQVIGFDMGGTSTDVAHFDG
EYERAFETEVAGVRVRAPMMLIHTVAAGGGSILHYEAGRFRVGPDSAGANPGPACYRNGG
PLAVTDANVMLGKLLPEFFPAIFGPQQNQPLDVARVRELFTALAGEIGDGRSPEAVADGF
IRIAVANMVEAIKKISVQRGYDVTRYALNCFGGAGGQHACLVADALGMKNILLHPMSGLL
SAYGMGLADIRATRQKALGVALDPAAPKALKELGEELADECVAELAAQGIETDAMKQHLR
AHIRYAGTDTALSIEATFPAEDDAARLRAEFEAAHKRRFGFIAENKALVIDAVEVEAVGG
GAGEMENAQSLDSDQEAKPAKLTRFFSQGEFHEAGVVLREAMQRGQTVTGPAIIIEKNQT
IVIEDGWQARLTAHDHVVLTRIKALPARTAIGTEADPVMLEIFNNLFMSIAEQMGVTLQN
TAYSVNIKERLDFSCAVFDAEGNLVANAPHMPVHLGSMDASVATAIRENKDIKPGDVFLI
NAPYNGGTHLPDLTVCTPVFDDAGHQIRFWVASRGHHADIGGIAPGSMSPLAVNIEQEGV
YIDNFKLVDRGTFREEALAALLTGATYPVRNLTQNVNDLKAQIAANEKGVAELKKMIGLF
GEDVVKAYMGHVQDNAAESVRRVLDRLPDGHFIYEMDQGCQIEVRVTIDREKREATVDFT
GTSEQRPDNFNAPEPVTRAAVLYVFRVLVEGDIPMNAGCLRPIRIIVPQGSMLSPRYPAA
VVAGNVEVSQAVTNCLFGATGAMAAAQGTMNNLTFGNDEYQYYETICSGAPAGPGFNGAD
AVHTHMTNSRLTDPEILETRLPVLLEDFHIRKGLGGKGKWHAGDGTRRTIRVLEKLDFAI
LSGHRRVRPFGLKGGKPGETGRKDGSVEVLKGCDQTLLEAGEAFTVITPTGGGYGEPE
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagcgtgggatttctggatcgaccgcggcggcacgtttaccgacgttatcggg
cgcgacccggaagggcatctccatgcccgcaaggttctctcggaaaacccttccgcctat
aaggacgcagccgttcacggcatccgcctgcatctgggtctcaaaaccggcgaaccggtg
cctgccggcatcattggcgaggtgcgcatgggcacaaccgttgccaccaatgcgcttctg
gaacgcaagggcgaacggctggcacttgttacgacaaagggttttcgcgatgcgctgaag
atcggctatcaggaacgcaagaacatctttgccaccgaaatcatcaagccggaagccctt
tacgataaggtcgtggaacttgacgagcgtgtgcgtgccgatggcacagtggaaaaggcg
ctcgccctcgcggaagcggaaaaagctcttcgtgccttgaaggcggaaggctataaatcg
atcgccattgccctcatgcgtgcctacaagtttccggcgcatgagattgaaattgctcgc
attgcccgcgatctgggtttcgagcaggtttccgtcagccatgaggtttcgccgctcatc
aaactcgtggggcgcagcgatacgacagtcgtggatgcctatctttccccggtgctgcgc
cgctatgtggcgcaggtttccgatgaactggacgtggaacgcaccggcgcgcgcgttatg
ttcatgatgtcctcgggcggcctgactgccgccgatctgtttcagggcaaggatgctatc
ctttccggccccgcaggcggcgtcgttggccttgcgcgcacgggcgaaacggctggcttc
gggcaggtcatcggttttgacatgggtggcacctccaccgatgttgcgcatttcgacggc
gaatatgaacgcgctttcgagacggaagtagcaggcgttcgcgtgcgcgcacccatgatg
ctgatccatacggttgccgcaggtggcggttcgatccttcattacgaagccggccgcttc
cgcgtcgggccggattcggcgggcgcaaatcccggccccgcctgctatcgcaatggtggc
ccgcttgctgttaccgacgccaatgtcatgcttggcaagcttctgccggagttttttccg
gcaatcttcggcccgcaacagaaccagccactcgatgtggcgcgcgtgcgcgaactcttc
accgcacttgcgggcgagatcggcgacgggcgctcgccggaggcggtcgcggatggtttt
attcgcattgccgtcgccaatatggtggaggcgatcaagaaaatttccgtccagcgcggc
tatgacgtgacgcgctatgcgctcaactgtttcggcggcgcgggcgggcaacatgcctgc
ctggtggccgatgcgctgggcatgaagaacattcttcttcatccgatgtcgggtctgctt
tccgcctatggcatggggcttgccgatattcgcgcaacgcgccagaaggcgcttggtgtc
gcgctcgatccggctgcacccaaggcactgaaagaactgggcgaggaactggcggacgaa
tgcgttgccgaacttgccgcgcagggcatcgagacagatgccatgaaacagcaccttcgc
gcccatatccgctatgcgggcaccgacacggctctttccatcgaggcgaccttcccggcg
gaagacgatgctgcgcgcctgcgcgccgaattcgaggccgcccataagcgccggttcggc
ttcatcgcggaaaacaaggcgctcgtcatcgatgcggttgaagtggaggccgttggcggc
ggcgccggtgaaatggaaaacgcccaatcgctcgacagcgatcaggaggcaaagcccgca
aagctgacgcgcttcttctcgcaaggcgaattccacgaggcaggcgtggtgctgcgtgaa
gcgatgcagcgcggccagactgtcactggcccggcgatcatcatcgagaagaaccagacc
atcgtgatcgaggatggctggcaggcgcgcctcaccgcgcatgaccatgtggtcctgacc
cgcatcaaggccctgcccgcccgcaccgcaatcggcaccgaagccgatccggtaatgctg
gaaattttcaataatctcttcatgtccattgccgaacaaatgggcgtgacgctgcaaaac
accgcctattcggtcaatatcaaggagcgtctggatttctcctgcgcggtcttcgatgcc
gagggcaatctcgtcgccaatgcgccgcatatgccggtgcatctgggttcgatggatgct
tccgtcgccaccgccatccgcgagaacaaggatatcaagccgggcgacgtctttctcatc
aacgcgccctataatggcggcacccacctgccggacctcaccgtctgtactcccgtcttc
gacgatgcagggcatcaaatccgcttctgggtggcaagccgtggccaccatgccgatatt
ggcgggatcgctcccggctccatgtcgccgcttgccgtcaatatcgagcaggaaggtgtc
tatatcgacaatttcaagctggtcgatcgcggcacattccgcgaggaagcactggccgca
cttctgacgggcgcgacctatccggttcgcaatctgacgcagaacgtcaacgacctgaag
gcgcagatcgccgccaatgaaaagggcgtggcggagctgaagaagatgatcggccttttc
ggcgaggacgtcgtgaaagcctatatgggccatgtacaggacaatgccgcagaaagcgtg
cgccgcgtgctggaccgcctgccggacggtcatttcatctatgaaatggatcagggctgc
cagatcgaggtgcgtgtcaccatcgacagggaaaagcgcgaggcgaccgtcgatttcact
ggcacttccgagcagcgccccgacaatttcaacgcgccggaacccgtcacccgtgccgcc
gtgctctatgtcttccgggtgctggtcgaaggcgatatcccgatgaatgcgggttgcctg
cgcccgatcaggatcatcgtgccgcaaggctccatgctgtcgccgcgttatcccgcagcg
gttgtggcgggcaatgtggaggtgagccaggccgtcaccaactgcctctttggcgcaacc
ggggccatggcggcggcacagggcaccatgaacaatctgacattcggcaatgacgaatat
cagtattacgaaaccatctgctccggcgcccccgcaggccccggcttcaacggcgccgat
gcggtccacacccatatgaccaactcacgccttaccgacccggaaattctggaaacccgc
cttcccgtgctgctggaggattttcatatccgcaaaggcttaggcggcaagggcaaatgg
catgcaggcgatggcaccagacgtacgatccgtgtgctggaaaagctcgacttcgccatt
ctctccggtcatcgccgtgtgcgccccttcgggctcaaaggaggcaagccgggcgaaacg
ggccgcaaggacggctcggtggaagtgctgaaaggatgcgaccagaccctgctggaagca
ggagaagccttcaccgtcattacccccaccgggggcggatacggcgaaccggaataa

DBGET integrated database retrieval system