KEGG   Brucella canis Oliveri: BCOUA_II0722Help
Entry
BCOUA_II0722      CDS       T03030                                 

Gene name
putA
Definition
(GenBank) putA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
bol  Brucella canis Oliveri
Pathway
bol00250  Alanine, aspartate and glutamate metabolism
bol00330  Arginine and proline metabolism
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCOUA_II0722 (putA)
   00330 Arginine and proline metabolism
    BCOUA_II0722 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bol03000]
    BCOUA_II0722 (putA)
Enzymes [BR:bol01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     BCOUA_II0722 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     BCOUA_II0722 (putA)
Transcription factors [BR:bol03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    BCOUA_II0722 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH Bombinin Psu
Motif
Other DBs
NCBI-ProteinID: CDL78256
Position
II:complement(702805..706488)
Genome map
AA seq 1227 aa AA seqDB search
MTDNIPVSKVAVFQNFAPPIREQSALRQAITAAYRRPEAECVSALAEQATLPEETRQQIR
STARKLIEALRAKHKGTGVEGLVHEYSLSSQEGVALMCLAEALLRIPDMATRDALIRDKI
SNGDWKSHIGGGRSLFVNAATWGLVVTGKLTNTVNDRGLSAALTRLIARCGEPVIRRGVD
MAMRMMGEQFVTGETIDEALKRAKELEERGFRYSYDMLGEAATTAADAERYYKDYETAIH
AIGRASAGRGIYDGPGISIKLSALHPRYTRAQSERVMGELLPKVKALAAIAKSYNIGLNI
DAEEADRLELSLDLLQSLCEDPDLAGWDGIGFVVQAYGKRCPFVLDFIIDLARRTKRRVM
VRLVKGAYWDAEIKRAQVDGLEDFPVYTRKVHTDVSYIACARKLLAATDVIFPQFATHNA
QTLATIYHLAGPDFKTGKFEFQCLHGMGEPLYDEVVGPEKLGRPARIYAPVGTHETLLAY
LVRRLLENGANSSFVNRIGDKNVSVDELIADPVEVVRSMAVVGARHDQIALPENLYGARR
NSAGFDLSNEVTLAELSKTLKETAGRAWTAEPQVAGAKVKGVSRPVLNPGDRNDVVGTVT
EIAEADVAKAMKAAQTATTSWSAVAPAERAACLERAADIMQRDMPALLGLVMREAGKSMP
NAIAEVREAIDFLRYYAEQTRRTLGVGHKALGPVVCISPWNFPLAIFTGQIAAALVAGNP
VLAKPAEETPLIAAEGVRILHEGGIPADALQLLPGDGRIGAALVAAPETCGVMFTGSTEV
ARLIQAQLASRLLPNGKPVPLIAETGGQNAMIVDSSALAEQVVFDVIASAFDSAGQRCSA
LRVLCLQEDVADRILTMLKGALRELSIGRTDQLKVDIGPVITDEAKNTIEKHIQAMRDLG
RKVEQLPLGPETQNGTFVAPTIIEIESLRDLKREVFGPVLHVVRYKRDDMESLIDDINST
GYGLTFGLHTRLDETIANVADRIRVGNIYINRNIIGAVVGVQPFGGRGLSGTGPKAGGPL
YLGRLVETAPIPPRHASVHTDAALKDFARGLGNRGMNDLAQAARDTGSASALGLELELPG
PVGERNLYALHPRGRVLLVPQTEIGLYRQLTAVLATGNTAVIDEACGLRAVLKDLPETVA
ARAIWTGDWQADAPFAGALIEGDSARIKEVNSRIAALPGPLVLTQAASPEDLAANQDAYC
LNWLLEEVSTSINTTAAGGNASLMAIG
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataatattcctgtttccaaagtggccgttttccagaattttgcgccgccgatc
cgcgagcaaagcgcactgaggcaagcgatcactgccgcttatcgccgccccgaagccgaa
tgcgtttcagcgctggccgagcaggcaaccttgccggaggagacgcgccagcaaatccgt
tccaccgcccgcaagctgatcgaagcgctgcgtgccaagcataagggcaccggcgtcgaa
ggtctggtgcatgaatattcgctgtcgagccaggaaggcgtggcgctgatgtgccttgcc
gaagccttgctgcgcattcccgatatggcgacgcgcgatgcgctgatccgcgacaagata
tcgaatggcgactggaaatcccacattggcggcgggcgctcgcttttcgtcaatgctgcg
acatggggcctggtcgttaccggcaagctcaccaataccgtcaatgatcgtggcctttcc
gccgctcttacccgcctcatcgcccgctgcggcgagccggtcatccgtcgcggcgtggac
atggccatgcgcatgatgggcgagcagttcgtcaccggcgaaaccatcgatgaggcgttg
aaacgcgccaaggagctggaagagcgcggcttccgctattcctacgacatgctgggcgag
gccgcgaccaccgccgccgatgcagagcgttattataaggattatgaaaccgcgatccac
gccatcggtcgtgcttccgcagggcgcggcatttatgatggtcccggcatttccatcaag
ctttcggcgcttcacccgcgttatacccgcgcgcaaagtgagcgcgtcatgggtgaactt
ctgccgaaggtgaaggcactcgcggccatcgccaagtcctataatatcggcctcaatatc
gacgcggaggaggccgaccgtcttgaactgtcgctcgacctgttgcaaagcctttgcgaa
gaccctgatctggcaggctgggatggcatcggcttcgtggtgcaggcctatggcaagcgc
tgccccttcgtgcttgatttcatcatcgatctggctcgccgcaccaagcgccgcgtcatg
gtgcgtctggtgaagggcgcctattgggatgcggagatcaagcgtgcgcaggtggatggg
ctggaggattttccggtctatacccgcaaggtgcatacggacgtttcctatattgcctgc
gcgcgcaagcttctggccgcgacggatgtgatctttccgcaatttgcgacccataacgcg
cagacactcgccacgatctatcatctggccgggccggatttcaaaaccggtaagtttgag
ttccaatgcctgcacggcatgggtgagccgctttatgatgaagtcgtcggccccgaaaag
ctcggtcgcccggcccgcatttatgcaccggtcggcacgcatgaaacgctgctcgcctat
ctcgtccgccgccttcttgaaaacggcgcgaactcctccttcgtcaaccgtattggcgac
aaaaacgtctcggtcgatgagctgatcgccgatccggtggaagtcgtccggtcgatggct
gtcgtcggtgcgcgtcatgaccagattgcgctgccggaaaatctctatggcgcgcgccgc
aattccgcaggctttgatctttccaatgaagtgacgcttgcggaactgagcaaaaccttg
aaggaaacggcaggccgtgcatggaccgccgaaccgcaggtggcgggtgcaaaggtgaag
ggcgtaagccgtccggttctcaatcccggcgaccggaatgatgttgtcggcaccgtaacg
gaaatcgcagaggccgatgtggcaaaggcgatgaaggcagcgcaaaccgcgaccacaagc
tggtccgcggttgcgcccgcagaacgcgccgcctgtctggagcgcgcagccgatatcatg
cagcgcgacatgccggctctgctcggcctcgtcatgcgcgaggcgggcaagtccatgccg
aacgctattgccgaagtgcgtgaagccatcgatttcctgcgctattatgccgaacagacc
cgccgcacgcttggcgtcggccacaaggcgcttggccctgtcgtctgcatcagcccgtgg
aacttcccgctggcaatcttcaccggccagattgcggctgcacttgttgcaggcaatccg
gttctggcaaagcctgccgaggaaaccccgctgatcgccgctgagggcgtgcgcattctg
catgaggggggcattccggcggatgcgctccagcttctgccgggtgatggccgcattggc
gccgcgctggttgcagcaccggaaacttgcggcgtaatgttcaccggctccaccgaggtg
gcgcggctcatccaggcgcagcttgcctcgcgcctgctgccgaacggaaagccggtcccg
ctcattgccgaaacgggcggtcagaacgccatgatcgtggattcctcggcacttgccgag
caggtggtgtttgatgtcatcgcttcggctttcgatagcgccggccagcgctgttcggcg
ctgcgtgtcctctgcttgcaggaagatgtggccgaccgcattctcaccatgctcaagggc
gccttgcgtgagctttccattggccgcacggaccagctcaaggtcgatatcggcccggtt
atcaccgatgaggcgaagaacaccattgaaaagcatattcaggccatgcgcgatcttggc
cgcaaggtggaacagcttccccttggcccggaaacgcagaacggcacttttgttgcgccg
acaatcatcgagattgaatcgctgcgcgatctcaagcgcgaagtgttcggcccggtcctg
catgtggttcgttacaagcgcgacgacatggaaagcctgatcgatgatatcaattcgacc
ggctatgggcttacttttggtttgcatacgcgccttgacgagacgattgccaatgttgcg
gatcgcatccgtgtcggcaatatctatatcaatcgcaacattatcggcgcagtggtgggc
gtgcagcctttcggcgggcgtggcctttccggcaccggcccgaaggcgggcggtccgctc
tatcttggccgtctggtcgaaaccgcgccgatcccgccgcgtcacgcttcggttcatacc
gatgcggcgctgaaggactttgcccgcgggctcggcaatcgcggcatgaacgatctggcg
caggcggcgcgcgataccggcagtgcttcggcgctcggtctcgaactcgaactgccgggc
ccggttggcgagcgcaatctctatgctctccacccgcgcgggcgcgtgcttctggtcccc
cagaccgaaattggcctctatcgccaattgacggcggtgctggcaaccggcaacactgcg
gtcatcgacgaggcttgcggtttgcgcgccgtgttgaaggatctgccggaaacagttgcc
gcgcgcgccatctggacgggcgactggcaggcggatgcgccttttgccggagcacttatc
gaaggcgacagcgcgcgcatcaaggaggtgaactccaggatcgccgccctgccgggaccg
ctcgtactcacacaggcggcatcgccggaagatcttgcagccaatcaggatgcttattgc
ctcaactggctgcttgaggaagtctcgacctccatcaacaccacggcagcaggcggcaac
gccagcctgatggcgatcggctga

DBGET integrated database retrieval system