KEGG   Brucella canis Oliveri: BCOUA_II0871Help
Entry
BCOUA_II0871      CDS       T03030                                 

Gene name
fbaA
Definition
(GenBank) fbaA
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bol  Brucella canis Oliveri
Pathway
bol00010  Glycolysis / Gluconeogenesis
bol00030  Pentose phosphate pathway
bol00051  Fructose and mannose metabolism
bol00680  Methane metabolism
bol01100  Metabolic pathways
bol01110  Biosynthesis of secondary metabolites
bol01120  Microbial metabolism in diverse environments
bol01130  Biosynthesis of antibiotics
bol01200  Carbon metabolism
bol01230  Biosynthesis of amino acids
Module
bol_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bol_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCOUA_II0871 (fbaA)
   00030 Pentose phosphate pathway
    BCOUA_II0871 (fbaA)
   00051 Fructose and mannose metabolism
    BCOUA_II0871 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    BCOUA_II0871 (fbaA)
Enzymes [BR:bol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BCOUA_II0871 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: CDL78397
Position
II:complement(855119..856183)
Genome map
AA seq 354 aa AA seqDB search
MARITLRQLLDHAAEKGYGVPAFNINNMEQALAIMEAANAVDAPVILQASRGARSYANDI
MLRHMMDAVTEIYPHIPVCVHLDHGNEAATCMSAIQAGFTSVMMDGSLKADGKTPADWDY
NVSVTRQVSEMSHLGGISVEGELGVLGSLETGMGDAEDGHGAEGKLSHDQLLTDPDEAVK
FVRETKVDALAIAMGTSHGAYKFSRKPDGSVLAMHVIEEIHRKLPNTHLVMHGSSSVPEE
LQEIINKYGGQMKPTWGVPVEEIQRGIKHGVRKINIDTDNRMAMTGQIRRILQEEPSEFD
PRKYLKSAMAAMTKLCKERFEQFGTAGHAASIRPIPLSEMAKRYRDGSLDPKFS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgcattacgctgcggcaattgctcgatcacgccgctgaaaagggttacggcgtt
ccggcattcaacatcaacaacatggaacaggcactggccatcatggaagcggcaaatgcc
gtggatgcgccggttatcctgcaggcttcgcgcggcgcgcgttcctatgccaatgacatc
atgctccgtcacatgatggatgccgtgacggaaatctatccgcatattccggtctgcgtg
catctcgaccatggcaacgaagccgccacctgcatgagcgccatccaggcgggcttcacc
tccgtcatgatggacgggtcgctgaaggccgacggcaagacgcccgccgactgggactat
aacgtctccgtcacgcgccaggtcagcgagatgtcgcatctgggcggcatttcggtggaa
ggtgagctcggcgttctgggttcgcttgaaaccggcatgggcgatgccgaagacggccat
ggcgcggaaggcaagctttcgcacgaccagcttctgaccgacccggatgaagctgtgaag
ttcgtgcgcgaaaccaaggtcgatgcgctggcaatcgccatgggcacctcgcacggcgct
tacaagttcagccgcaagccggatggttccgtgctcgccatgcatgtgatcgaggaaatc
catcgcaagctgccgaacacccaccttgtcatgcatggttcgtcgtcggtgccggaagaa
ttgcaggaaatcatcaacaagtatggcggccagatgaagccaacctggggtgtgccggtt
gaggaaatccagcgcggcatcaagcatggcgtgcgcaagatcaacatcgatacggataac
cgcatggcgatgaccggccagatccgccgcatcttgcaggaagaaccgagcgaattcgat
ccgcgcaagtacctcaagtccgccatggctgcgatgaccaagctgtgcaaggagcgtttc
gagcagttcggcaccgccggtcacgcggcttccatccgcccgatcccgctttccgaaatg
gcaaagcgttatcgcgacggttcgctggacccgaagttcagctaa

DBGET integrated database retrieval system