KEGG   Brucella canis Oliveri: BCOUA_II0911Help
Entry
BCOUA_II0911      CDS       T03030                                 

Gene name
nagA
Definition
(GenBank) nagA
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bol  Brucella canis Oliveri
Pathway
bol00520  Amino sugar and nucleotide sugar metabolism
bol01100  Metabolic pathways
bol01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BCOUA_II0911 (nagA)
Enzymes [BR:bol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BCOUA_II0911 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: CDL78436
Position
II:complement(893086..894252)
Genome map
AA seq 388 aa AA seqDB search
MMKKSAIAGARIFDGERFHDQSALVFSDGQIEAIVPEASLAEGHEIERLKGGVLAPGFID
AQVNGGGGRMLNDEPTLETMFVIAGGHRKYGTTSLLPTLITDTMPVRDRAIEAAIEAVKA
DRGVAGLHLEGPHLAPARKGAHLAELMRPVNDADIALYIHTARQIGTLLVTLAAEQVTPE
QVRRLSDGGVIVSIGHSDTTAEEAFRRFDAGARSVTHLYNAMSQIGHRAPGLAGAALDHP
DIWCGIVADGHHVDPMALRLALRAKRGDAHLFLVTDAMALVGSDAESFEINGRSVRRVPG
GICSKLVLPDGTIAGSDLDMASAVRFAVAELELTLAEALRMASLYPARYLRLNDRGRFRP
GMRMDAVHLDDGLFAKSTWLSGEKQIAG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaatcagcaattgcaggcgcgcgcatcttcgacggtgagcgctttcatgac
cagagcgcgctggtattcagcgatggccagatcgaggccatcgtaccggaagcatcgctt
gccgagggccacgaaatcgaaaggctgaagggcggcgttcttgcccccggtttcatcgat
gcgcaggtgaatggcggcggcgggcgtatgctcaatgacgagccgacgctcgaaaccatg
ttcgtgattgccggcgggcacaggaaatacggcacgaccagcctgttgccgacgctcatc
accgatacgatgcccgtgcgtgaccgcgccattgaggcggcgattgaagcggtgaaggct
gacaggggggttgctggcctgcatctggaaggcccgcatctggcgccagcgcgcaaaggc
gcgcatctggcggaactgatgcgcccggtcaatgatgccgatattgcgctctatatccat
acagccaggcagattggcaccttgctggtgacgctcgcggccgaacaggtgacgcctgaa
caggtgcgccgcttgagcgatggaggcgtgatcgtcagcattggccacagcgacacgacc
gctgaagaagccttccggcgcttcgatgccggtgcgcgcagcgtgacgcatctttataat
gccatgagccagattggtcatcgcgcgccgggtcttgccggtgcggcgctcgatcatccc
gatatctggtgcggtatcgttgcggatgggcatcatgtcgatccgatggcgctgcggctg
gcgctgcgtgccaagcgcggcgatgcgcatctgttcctcgtgacggacgccatggcgctt
gtcggatcggatgcggaaagcttcgagataaacgggcgcagcgttcgccgtgtgccgggc
ggcatctgctccaagctggtcctgccggatggcaccattgccggttccgatctcgacatg
gcttcggcggtgcggtttgccgtggcagaactggaactgacgcttgccgaggcgctgcgc
atggcaagcctctatccggcgcgctatctgcgccttaatgatcgcggccggttccgtccg
ggaatgcgcatggatgccgtgcatctggatgacgggctgttcgccaaatccacatggctt
tccggcgaaaagcagattgcaggctga

DBGET integrated database retrieval system