KEGG   Bos mutus (wild yak): 102264376Help
Entry
102264376         CDS       T02919                                 

Definition
(RefSeq) epididymal secretory glutathione peroxidase-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00480  Glutathione metabolism
bom00590  Arachidonic acid metabolism
bom01100  Metabolic pathways
bom04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102264376
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102264376
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    102264376
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     102264376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 102264376
NCBI-ProteinID: XP_005911630
Position
Un
AA seq 87 aa AA seqDB search
MTIQLRASCLFLFFLAGFVQTNSNLEKMDCYKDVKGTIYDYDAFTLNGKEHIQFKQYAGK
HVLFVNVATYCGLTAQYPELNALQEEL
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgactatacagttaagggcctcttgtctttttctctttttcctagccggctttgtgcag
acaaattccaatctagagaagatggattgctacaaagatgtgaaaggcactatctatgat
tatgatgctttcactcttaatggaaaggaacacattcagttcaagcaatatgcgggcaag
catgtcctttttgtcaatgtggccacctattgtggtctgacagctcaatatcctgaactg
aatgcactacaggaggagctg

DBGET integrated database retrieval system