KEGG   Bos mutus (wild yak): 102265334
Entry
102265334         CDS       T02919                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bom01002]
    102265334 (ERAP1)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     102265334 (ERAP1)
Peptidases and inhibitors [BR:bom01002]
 Metallo peptidases
  Family M1
   102265334 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 102265334
NCBI-ProteinID: XP_005899357
Position
Un
AA seq 935 aa
MISPSRPLLLLTLLILLTVATPSSCQSREPTSPKASNGAPFPWNKIRLPEHIIPAHYDLM
IHANLTTLTFGGTTQIEITASKPTSTIILHSHRLQISKAALRKGGGERQAEEPLRVLENP
PQEQIALLASEPLVVGLPYTIVIDYAGNLSESFHGFYKSTYRTKEGEVRILASTQFEPTA
ARMAFPCFDEPAFKASFLIKIRREPRHLAISNMPLVKSVTVAEGLIEDHFDVTVRMSTYL
VAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQ
DLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMIVSHELAHQWFGNLVTM
EWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPVSTPVENP
AQIREMFDEVSYDKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLWKSMASIC
PTDDTQRMDGFCSRGEHASSTAHWRQEGLDVKTMMNTWTLQKGFPLITITVRGRNVHMKQ
EYYVKGVADAPETGFLWHVPLTFITSKSDAVQRFLLKTRTDVLILPEEVEWIKFNVGMNG
YYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALDLTLYLKH
ETEIMPVFQGLNELIPMYKLMEKREMNEVETQFKAFLIRLLRDLIDKQTWTDEGSVSERM
LRSQLLFLACVRKYQPCVQKAEGYFRQWQEAGGNLSLPNDVTLAVFAVGAQTLEGWDFLY
SKYQSSLSSTEKNRIEFALCISQNKEKLQWLLDQSFKGDVIKTQEFPDILRAIGRNPVGY
PLAWQFLRENWNKLVQKFELGSNSIAYMVTGTTDQFSTRARLEEVKEFFSSLKENGSQLR
CVQQTIETIEENIRWMDKNFDKIRAWLQNEKLNLL
NT seq 2808 nt   +upstreamnt  +downstreamnt
atgatatctccatccaggcccttactgcttttgacactgctgattctcttaacggtggca
actccatcctcatgtcagagcagggaaccaacatctccaaaagctagcaacggggcacca
tttccttggaataaaattcgacttccagagcacatcatcccagctcattacgatctcatg
attcacgcaaacctcaccactctgactttcgggggaaccacacagatagaaatcacagcc
agcaagcccaccagtaccatcatcctgcacagtcaccgcctacaaatatccaaggccgcc
ctgaggaagggaggtggcgagaggcaggctgaagagccactgagagtcctggaaaaccca
cctcaggagcagattgcgcttctggcttctgagccgctggtcgtcggcctcccatacacc
attgtcatcgactacgctggcaatctttctgagagtttccatggattttataaaagtacc
tacagaaccaaggaaggagaagtgaggatacttgcatcaacacagttcgaaccaactgca
gccagaatggcctttccctgctttgatgaacctgctttcaaggcgagttttttaatcaag
atcagaagggaaccaagacacctcgccatctccaatatgccactggttaaatctgtgact
gtggctgaaggactcatagaagaccactttgacgtcaccgtgaggatgagcacctacctg
gtggccttcattgtttcggatttcaagtctgtcagcaagatgaccaagagcggagtcaag
gtttccgtatatgctgttccagacaagataaatcaggcagactatgcactggatgccgcg
gtgactcttctagaattttatgaagattatttcagcatcccgtatccgttacccaaacaa
gatcttgctgcgattcccgacttccaatctggtgcaatggaaaactggggactgacgaca
tacagggaatcttctctactgtttgatgctgagaagtcttccgcctcaagtaagcttggc
atcacgatgattgtgtctcatgaactcgcccaccagtggtttgggaacctcgtcactatg
gaatggtggaatgatctttggctaaatgagggatttgccaagtttatggagttcgtgtca
gtcagtgtgactcatccagaactgaaagttgaagattatttctttggtaagtgtttcaac
gcaatggaggtggatgcattaaactcctcacaccccgtgtccacacccgtggagaaccct
gctcagattcgggagatgtttgatgaagtttcttatgacaagggagcttgtattctgaat
atgctaagggactatcttggtgccgatgcatttaaaagtggcattgtaaagtatctgcag
aagtatagctataaaaacacgaaaaacgaggacctgtggaaaagtatggcgagcatttgc
cctacagatgacacacaacgcatggatggattttgttctagaggtgaacatgcatcttca
accgcgcactggcgacaggaaggccttgatgtgaaaaccatgatgaacacctggacgctg
cagaagggtttccccctgataaccatcaccgtgagaggcaggaacgtacatatgaagcaa
gagtactatgtgaaaggcgtggccgatgccccagaaactgggttcctgtggcatgtccca
ctgacattcattaccagcaaatcagacgcagtccaacgctttttgctgaagacaagaaca
gatgtgctcatcctcccagaagaggtggaatggatcaaatttaatgtcggaatgaatggc
tattacattgtgcattatgaggatgatggatgggactctctgactggccttttaaaagga
acacacacggcaatcagcagtaacgatcgggccagtctcattaacaatgcatttcagctt
gtcagcattggaaagctgtcaattgaaaaagccttggatttaaccttgtacctgaagcat
gaaactgaaatcatgccagtgtttcaaggtttgaatgagctgataccgatgtataagtta
atggagaagagagagatgaatgaagtggaaactcaattcaaggcctttctcatcaggctg
ctgagggacctcattgacaagcagacgtggacggatgagggctccgtctcagagcgaatg
ctgcggagtcagctgctcttcctcgcctgcgtgcgcaagtaccagccctgcgtgcagaag
gcagaaggctatttcagacagtggcaggaagccggtggaaacctcagcctgcccaacgat
gtgaccttggcagtgtttgccgtgggggcccagaccctcgaaggatgggattttctttat
agtaaataccagtcgtcattgtccagtactgagaaaaaccgaattgaatttgctctctgt
atcagccaaaataaagaaaagcttcagtggctactagatcaaagttttaagggagatgta
ataaaaactcaagagtttccagatattcttagagctattggcagaaacccagtgggatat
ccgttggcctggcagtttctgagggaaaactggaacaaacttgtgcaaaagtttgaactt
ggctcaaattccatagcctacatggtaacgggaacaacagatcagttctcaacaagagca
cggctcgaagaggtaaaagaattcttcagctctttgaaggaaaacgggtctcagctccgt
tgtgttcaacaaaccatcgaaactatcgaggaaaacatacgttggatggataagaatttt
gataagatcagagcgtggctgcaaaatgagaagcttaatctgctataa

DBGET integrated database retrieval system