KEGG   Bos mutus (wild yak): 102266645
Entry
102266645         CDS       T02919                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
bom  Bos mutus (wild yak)
Pathway
bom04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102266645 (ASIC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bom04040]
    102266645 (ASIC1)
Ion channels [BR:bom04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   102266645 (ASIC1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 102266645
NCBI-ProteinID: XP_005892076
Position
Un
AA seq 559 aa
MPIQIFCSVSFSSGEEAPGPLGDVWGPHQQQQRDSSDSEEEEEEKEKEAERKEAREADSP
MDLVAFANSCTLHGTNHIFVEGGPGPRQALWAVAFVLALGAFLCQVGDRVAYYLSYPHVT
LLDEVATTELAFPAVTLCNTNAVRLSQLSYPDLLYLAPMLGLDESDDPGVPLAPPGPEAF
SGEPFNLHRFYNRSCHRLEDMLLYCSYCGGPCGPHNFSVVFTRYGKCYTFNSGRDGRPRL
KTMKGGTGNGLEIMLDIQQXESRPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAP
GFQTFVACQEQRLIYLPPPWGTCKAVTMDLDFFDSYSITACRIDCETRYLVENCNCRMVH
MPGDAPYCTPEQYKECADPALDFLVEKDQEYCVCEMPCNLTRYGKELSMVKIPSKASAKY
LAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGDIGGQMGLFIGASILT
VLELFDYAYEVIKHKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTY
AANILPHHPARGTFEDFTC
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcccatccagatcttctgctccgtgtcattctcctctggagaggaggcccccgggccc
ttgggagatgtatggggtccccatcagcagcaacaacgggacagctcagactcagaagag
gaggaagaagagaaggaaaaggaggcagagaggaaggaggccagagaggcggactcaccg
atggacctggtggccttcgccaacagctgtaccctccacggcaccaaccacatcttcgtg
gaggggggtcctgggccgcggcaggccctgtgggcagtggccttcgtcctggcactggga
gccttcctgtgccaggtaggggatcgagttgcctattacctcagctacccacatgtgact
ctgctagacgaagtggccaccacggagctggccttcccagcggtcaccctctgcaacacc
aatgcagtgaggctgtcccaactcagctaccccgacctgctgtacctggcccccatgctg
gggctggacgaaagcgacgacccgggggtgccgctcgcccccccagggcccgaggccttc
tcgggggagccctttaacctgcaccgcttctacaatcgctcctgtcaccggctggaagac
atgttgctctactgctcctactgcggggggccctgtggccctcacaacttctcggtggtc
ttcacgcggtatggaaagtgctacacgttcaactctggccgagatgggcgcccacggctg
aagaccatgaagggtgggacgggcaacgggctggagatcatgctggacattcagcagncc
gagtcccggcccgtgtggggggaaaccgatgagacgtccttcgaagcaggcatcaaagtg
cagatccacagtcaggatgaacctcccttcatcgaccagctgggctttggcgtagcccca
gggttccagacctttgtggcctgccaagagcagcggctcatctacctgcccccgccctgg
ggcacctgcaaagctgttaccatggacttggatttcttcgactcctacagcattaccgcc
tgccgcatcgactgtgagacgcgctacctggtggagaactgtaactgccgcatggtgcac
atgccaggggacgccccatactgcactccagagcagtacaaggagtgtgcagatcctgct
ctggacttcctggtggagaaggaccaggaatactgtgtgtgtgaaatgccctgcaacctg
acccgctatggcaaggagctgtccatggtcaagatccccagcaaagcgtcagccaaatac
ttggccaagaagttcaacaagtctgagcagtacataggggaaaacatcctggtgctggac
attttctttgaagtcctcaactatgagaccattgagcagaagaaggcctatgagattgca
gggctcctgggtgacattggaggccaaatggggctgttcatcggggccagcatcctcacg
gtgctggaactctttgactacgcctacgaggtcataaaacacaagctgtgcagaagaggg
aagtgccagaaggaggccaaacggagcagcgcggacaagggcgtggccctcagcctggat
gacgtcaaaagacacaacccgtgcgagagcctccggggccatcctgccgggatgacgtat
gcggccaacatcctacctcaccatccggcccgaggcacttttgaggactttacctgctga

DBGET integrated database retrieval system