KEGG   Bos mutus (wild yak): 102266889Help
Entry
102266889         CDS       T02919                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol-polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00010  Glycolysis / Gluconeogenesis
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102266889 (MINPP1)
   00562 Inositol phosphate metabolism
    102266889 (MINPP1)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     102266889 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     102266889 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 102266889
NCBI-ProteinID: XP_005906623
Position
Un
AA seq 482 aa AA seqDB search
MPRGPCSLVRVSATPVAVLAVALVSSLSRCSLLEPENSVVSALSPYFGTKTRYEDANPGL
LRDPEVPRRDPELLEETCTPVQLVALIRHGTRYPTTKQIRKLRQVPGRVPGPGGPXXXXX
XXXGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLQLVTSSK
HRCMDSGAAFLQGLWQHYHPGLPPPDIADMECGPPRINDKLMRFFDHCEKFLTQVERNAT
ALYHVEAFKTGPEMQNILKKVADILQVPVNNLNADLIQVAFFTCSFDLAIKGVKSPWCDV
FDIDDAKVLEYLNDLKQYWKRGYGYSINSRSSCTLFQDIFQHLDKAVKQKQRSHPVSSPV
ILQFGHAETLLPLLSLMGYFKDKEPLTAYNYKEQMHRKFRSGHIVPYASNLIFVLYHCKN
AKTPKEEFRVQMLLNEKVLPLAHSQETVSLYEDLKNHYKDILQSCHTSEECELPKVNTSD
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcggcccgtgcagcctcgtcagggtctccgcaacgcccgtcgcggtcctggct
gtggcgctggtctcgtcgctctctcgctgctccctcctggagccggagaacagtgtggtt
tccgcgctcagcccctactttggcaccaagactcgctacgaggatgccaaccccgggctg
ctgcgggaccccgaagtgccgcggcgggacccggagttgttagaggagacctgcaccccg
gtgcaactggtcgccctcatccgccatggcacccgctacccgacgaccaaacagatccgc
aagctgcggcaggtgcccgggcgggtgccgggccccgggggcccnnnnnnnnnnnnnnnn
nnnnnnnggggcgccgcgctggccgactggccgctgtggtacgctgactggatggacggg
cagctggtggagaaggggcggcaggacatgcgacagctggccctgcgcctggcctccctt
ttccctgccctcttcagccgagagaactacggccgcctgcagctagtcaccagctccaag
caccgctgcatggacagcggcgccgccttcctgcaagggctctggcagcactaccacccg
gggttaccgccacccgacatcgcagatatggagtgtggacctccaagaattaatgataaa
ttaatgaggttctttgatcattgtgagaagtttttaactcaagtggaaaggaatgctact
gctctttatcacgtagaagccttcaaaactggaccagaaatgcagaacatattaaaaaaa
gttgcagatattttgcaagtgccagtcaacaacttaaatgcagatttaattcaggtagct
tttttcacctgttcctttgacctggcaattaaaggtgttaaatctccttggtgtgatgtt
tttgacatagatgatgcaaaggttttagaatatttaaatgatctgaaacaatattggaaa
agaggatatgggtattctattaacagtcgatccagctgcaccctgtttcaggatatcttt
cagcacttggacaaagcagttaaacagaaacaacgttctcacccagtttcctccccagtc
atcctccagtttggccatgcagagacccttcttccgctgctttctctcatgggctacttc
aaagacaaggagcccctgacagcctacaattacaaggagcaaatgcatcggaagttccga
agtggtcacattgtaccctatgcttcaaacctgatatttgtgctttaccattgtaaaaat
gctaagactcctaaagaagaattccgagtgcagatgttactgaatgaaaaagtgttacca
ttggctcactcacaagaaactgtttctttgtatgaagatctgaagaaccactataaggac
atccttcagagttgtcataccagtgaagaatgtgaactaccaaaggtgaacacgtctgat
gagctatga

DBGET integrated database retrieval system