KEGG   Bos mutus (wild yak): 102266990Help
Entry
102266990         CDS       T02919                                 

Gene name
CDKL2
Definition
(RefSeq) cyclin dependent kinase like 2
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bom01001]
    102266990 (CDKL2)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     102266990 (CDKL2)
Protein kinases [BR:bom01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   102266990 (CDKL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 Haspin_kinase Kinase-like Kdo APH
Motif
Other DBs
NCBI-GeneID: 102266990
NCBI-ProteinID: XP_005909180
Position
Un
AA seq 492 aa AA seqDB search
MEKYENLGLVGEGSYGMVMKCRNKDSGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRH
ENLVNLLEVCKKKKRWYLVFEFVDHTVLDDLELSPNGLDYQLVQKYLFQVINGIGFCHSH
NIIHRDIKPENILVSQSGVVKLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYG
KAVDVWAIGCLVTEMLMGEPLFPGDSDIDQLYHIMVCLGNLIPRHQELFYKNPVFAGVRL
PEIKETVPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFHMDGFAERFPQEL
QLKVQKDARNISLSKKSQIRKKEKEKDESLGEERKTLVVQDTNADPQTKDSKVFKIKESK
TDGEKVEKASRASNASCLNDNGMSPVKIVPSTSLRNCSNGSVDQTRNPGMAIPPLTHNLS
ATAPTITSGMGTISGIQSYRVDEKTKKYCIPFVKPNKHSPPGAYNINVTTLVSKSPLSDD
SEADLPPVEHQH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatgagaacctaggattggttggagaagggagctatggaatggtgatgaag
tgtaggaataaagatagtggaagaattgtggccatcaagaagttcttagaaagtgatgat
gataaaatggttaaaaaaattgccatgcgagaaatcaagttactaaagcaactaaggcat
gaaaatctggtgaatttgttggaagtatgtaagaaaaaaaagcgatggtacctagtcttt
gaatttgttgaccatacagttcttgatgacctggagctctctccaaatggactagactac
caactagttcaaaagtatttgtttcaggttatcaatgggattggattttgtcacagtcac
aatattatacacagagatattaagccagagaacatattagtctcccagtctggcgttgtc
aagctatgtgattttggatttgcacggacactggcagctcctggggaggtgtatactgat
tacgtggcaacgcgatggtatagagctccagagctgttggttggtgatgtcaagtatggc
aaggctgttgatgtgtgggccatcggctgtctggtaactgaaatgctcatgggggagccc
ctctttcctggagattctgatattgatcagttatatcatattatggtgtgtttagggaat
ctaattccaagacatcaggagctgttttataaaaatcctgtgtttgctggagtaaggttg
cctgaaatcaaagaaactgtacctctggaaagacgctatcccaaactctctgaagttgtg
attgatttagcaaagaaatgcttacatattgacccagacaaaaggcccttctgtgctgag
ctcctgcaccatgatttcttccatatggatggatttgctgagaggtttcctcaggaactg
cagttaaaagtacagaaagatgccagaaacatttctttatctaaaaaatctcaaatcaga
aagaaggaaaaggaaaaggatgagtccttgggtgaagagagaaaaacacttgtggtacag
gataccaatgctgatccccaaactaaggattctaaagtatttaaaataaaagaatcaaaa
acagatggagaaaaagtggaaaaagcgagtcgagcttcaaatgccagctgtctcaatgac
aatgggatgagccccgtcaaaatagtgccttcaacaagcctccgaaattgcagcaatggc
agcgtggaccaaacaagaaatccaggcatggcaattcccccactcacacacaatctttct
gcaacagctcccactattacttctggaatgggaactatctcaggaattcagagttacaga
gtggatgagaaaaccaagaagtattgtattccatttgttaaaccaaataaacattctcca
ccaggagcttataatattaatgtgaccacattggtatcaaaatctcccctgtcagatgat
tcagaggctgatttgcctcccgtggaacaccagcactga

DBGET integrated database retrieval system