KEGG   Bos mutus (wild yak): 102268258
Entry
102268258         CDS       T02919                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00230  Purine metabolism
bom00240  Pyrimidine metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102268258 (DCK)
   00240 Pyrimidine metabolism
    102268258 (DCK)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     102268258 (DCK)
SSDB
Motif
Pfam: dNK Thymidylate_kin AAA_18 AAA_28 AAA_33 DUF932 CoaE
Other DBs
NCBI-GeneID: 102268258
NCBI-ProteinID: XP_005897117
Position
Un
AA seq 260 aa
MATPPKRSCPSPAASSEGTRIKKISIEGNIAAGKSTFVNILKQVCEDWEVVPEPVARWCN
VQSTQDEFEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAALNGKLKDAE
KPVLFFERSVYSDRYIFASNLYESDCMNETEWTIYQDWHDWMNNQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQEVPILTLDVNE
DFKDKHDSLIEKVKDFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccacccaagaggagctgcccgtctcccgcagccagctctgaggggacccgc
atcaagaaaatttccatcgaagggaacatcgctgctgggaagtcaacatttgtgaatatc
cttaaacaagtctgtgaggactgggaagtggtgcctgaacctgttgccaggtggtgcaat
gttcagagtactcaggatgaatttgaggaactgacaacatctcagaaaagtggcgggaat
gttcttcagatgatgtatgagaaacctgaacgatggtcttttaccttccagtcatatgcc
tgcctcagtcgaatacgagctcagcttgccgctctcaatggaaaactcaaagatgcagag
aaaccagtattattttttgaacgatctgtgtatagtgacaggtatatttttgcatctaat
ttgtatgaatctgactgcatgaatgaaacagagtggaccatttatcaagactggcatgac
tggatgaataaccagtttggccaaagccttgaactggatggaatcatttatcttagagcc
actccagagaaatgcttgaatagaatatatttacggggaagaaatgaagaacaaggcatt
cctcttgaatacttggagaaacttcactataagcatgaaagctggctcctgcatagaaca
ctaaaaaccaactttgattatctacaagaagtgcctatcttaacactggatgttaatgaa
gactttaaagacaaacatgacagtctaattgaaaaggtaaaagactttttgagcactttg
tga

DBGET integrated database retrieval system