KEGG   Bos mutus (wild yak): 102269146Help
Entry
102269146         CDS       T02919                                 

Gene name
CHRNA4
Definition
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
bom04725  Cholinergic synapse
bom05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102269146 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    102269146 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    102269146 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bom04040]
    102269146 (CHRNA4)
Ion channels [BR:bom04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   102269146 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 102269146
NCBI-ProteinID: XP_005911149
UniProt: L8HM79
Position
Un
AA seq 614 aa AA seqDB search
MKLGGPGTSPLPPLLLLLLGAGLLPVSSHAETRAHAEERLLKKLFSGYNKWSRPVANISD
AVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLHWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVSMHSRVDQLDFWDSGEWVIVDAVGTYNTRKYECCAEVYSDITYAFIIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKR
PSVVKDHCRRLIESMHKTASTPHFWPEPQGEPARSPSLTCGVDQPIKPQPAHTTPSDQVP
TLQPSETEKASPCLSPGPCRPLTGTQAPGLTKSRSLSVQHVSSPSKAVEDGVRCRSRSIQ
YCGPREEAASPATHLADSSPSSPTKAPSAKLPPPDQAASCKCQCRKEPGAPNATLKTSST
RAPPLPLSPALARAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDRIFLWVFIIVCLLG
TAGLFLPPWLAGMI
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgggggcccggggacgtcgccgctgccgccgctgctgctgctgcttctaggg
gccggcctcctgcctgtgagcagccatgcagagacccgggctcatgcggaggagcggctg
ctgaagaagctcttctctggctataataagtggtcccggcctgtggctaacatctcggat
gcggttcttgtccacttcggcctatccatcgcacagctcattgatgtggatgagaagaac
cagatgatgacgacgaatgtgtgggtgaagcaggagtggcacgactataagctgcactgg
gaccccgccgactatgagaacgtgacttccatccgaatcccctctgagctcatctggcgg
ccagacatcgtcctgtacaacaacgcggacggggactttgccgtcacccacctgaccaag
gcccacctcttccacgacggccgggtgcagtggacgcccccagccatctacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaagttcggg
tcctggacctacgacaaggccaagattgacctggtgagcatgcacagccgcgtggaccag
ctggacttctgggacagcggtgagtgggtcatcgtggacgccgtgggcacctacaacaca
cgcaagtacgagtgctgcgcggaggtctactcggacatcacctacgccttcatcatccgg
cgcctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgcttgtcttctacctgccctccgagtgcggcgagaagatcaccctctgcatctcc
gtgttgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccatccacctcg
ctggtcatcccgctcatcggcgaatacctgctcttcaccatgatcttcgtcacgctctcc
atcatcatcaccgtcttcgtgctcaacgtgcaccaccgctccccgcgcacacacaccatg
cccgcctgggtccgccgcgtcttcctggacatcgtgccgcgcctgctcttcatgaagcgg
ccgtctgtggtcaaggaccactgccggcggctcattgagtccatgcacaagacggccagc
actccgcacttctggccggagccccagggggagcccgcccggtctccatccctgacctgt
ggggtggaccagcccatcaagccccagccagcccatacaacaccctctgaccaggtgccg
actctgcagccttcagagaccgagaaggccagcccctgcctatctcctgggccctgccgt
ccactcactggcacccaggccccagggctcaccaaaagccggtccctaagtgtccagcac
gtgtccagccccagcaaagcggtggaggacggtgtgcggtgccggtcccggagcattcag
tactgcgggccgcgagaggaggccgcctcaccagccacccacctggcggatagctccccc
tcctctccgaccaaggccccctcagccaagctcccgcccccagaccaggctgcctcctgc
aaatgccagtgcaggaaggagccgggggccccaaatgccacgctcaagacctccagcacc
agagcaccacccctgcccctgtcgccagccctggcacgggcggtggagggcgtccagtac
atcgcagaccacctgaaggcggaagacacagacttctcggtgaaagaggactggaagtac
gtggccatggtcattgaccgcatctttctctgggtgttcatcatcgtctgcctgctggga
actgctggcctcttcctgccgccctggctggccggcatgatctag

DBGET integrated database retrieval system