KEGG   Bos mutus (wild yak): 102269871Help
Entry
102269871         CDS       T02919                                 

Gene name
FKBP7
Definition
(RefSeq) FK506 binding protein 7
  KO
K09573  FK506-binding protein 7 [EC:5.2.1.8]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bom03110]
    102269871 (FKBP7)
Enzymes [BR:bom01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     102269871 (FKBP7)
Chaperones and folding catalysts [BR:bom03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    102269871 (FKBP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_6 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 102269871
NCBI-ProteinID: XP_005907582
UniProt: L8HU53
Position
Un
AA seq 218 aa AA seqDB search
MHFLFRLILFFYVWGIFTAQGQKAEETTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGFL
AKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIGMMDMCPGEKRKLIIPPSFAYGKEGY
AEGKIPPDATLIFEIELYAVTKGPRSVETFKQIDTDNDRQLSKIEISHYLKKEFEKDEKP
RDQSYQTAVLEDFFKKNDHNGDGFISSKEYNVYQHDEL
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcttattcagattaatccttttcttttacgtgtggggcatttttactgctcag
ggacaaaaggcagaggagaccacagaggaagtgaaaatagaagttttgcatcgtccagaa
aattgttctaagacaagcaaaaagggagacctgctaaatgcccattacgacggcttcttg
gctaaagacggctcgaaattctactgcagccggacacaaaatgaaggccaccccaaatgg
tttgttcttggtgttggacaagtcataaaaggcctagacattgggatgatggatatgtgt
cctggagagaagcgaaaattgattatacctccttcatttgcatatggaaaggaaggctat
gcagaaggcaagattccacctgatgcaacattgatttttgagattgaactttatgctgtg
accaaaggaccacgaagcgttgaaacgtttaaacagatagacacggacaatgacaggcaa
ctttctaaaattgagataagtcattacctgaaaaaggaatttgaaaaagatgagaagcca
cgtgaccagtcatatcagactgcagttttagaggatttttttaagaagaacgaccataat
ggtgatggcttcatttcttctaaggaatacaatgtctatcaacatgatgaactatag

DBGET integrated database retrieval system