KEGG   Bos mutus (wild yak): 102270792Help
Entry
102270792         CDS       T02919                                 

Gene name
RDH13
Definition
(RefSeq) retinol dehydrogenase 13
  KO
K11161  retinol dehydrogenase 13 [EC:1.1.1.300]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102270792 (RDH13)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     102270792 (RDH13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 102270792
NCBI-ProteinID: XP_005903159
Position
Un
AA seq 335 aa AA seqDB search
MSRYVLPLSVLGTAVGGAVLLKDFVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAK
RGGNIILACRDMEKCEAAAKEIRGETLNHRVNARHLDLASLKSIREFAAKVTEEEEHVHI
LINNAAVMRCPHWTTEDGFEMQLGVNYLGHFLLTNLLLDKLKASAPSRIINVSSLAHVAG
HIDFEDLNWEKRKYDTKAAYCQSKLAVVVSTKELSRRLQGAGVVLNALHPGVARTELGRH
TGMHSSAFSSFTLGPIFWLLVKSPQLAAQPSVYLAVAEELEGVSGKYFDVLKEKPPAPEA
EDEEVAKRLWAESVRLVGLEMSHGSHGKRGQPLPK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctacgttctgccgctgtccgtgctgggcacggccgtgggcggcgccgtgctg
ctcaaggactttgttgcgggcggggcttgtcccagcaaggccaccattcccgggaagact
gtcattgtgactggtgccaacacgggcatcgggaagcagactgccttggagctggccaaa
agaggaggcaacatcattctggcctgtcgagacatggagaagtgcgaagcggcggccaag
gagattcgaggggagaccctcaatcaccgtgtcaacgcccggcacctggacttggcctcc
ctgaagtccatccgagagttcgcggcgaaggtcactgaagaggaggagcacgttcacatc
ctgatcaacaacgcggccgtgatgcggtgcccgcactggaccacggaggacggctttgag
atgcagcttggcgttaactacctgggccacttccttttgacaaacttgctactggacaag
ctgaaagcctccgccccttcacgcatcatcaacgtctcatccttggcccacgttgctggg
cacatagacttcgaggacttgaactgggagaagaggaagtatgacacgaaggcagcctac
tgccagagcaagctggccgtcgtcgtctccaccaaggagctgagccggcggcttcaaggt
gccggagtggtgctcaacgccttgcatcccggtgtggccaggacagagctgggcagacac
acgggcatgcacagctccgccttctccagcttcacgcttgggcccatcttctggctgctg
gtcaagagcccccagctggcggcccagcccagcgtctacctggccgtggcggaggagttg
gagggcgtttctggaaagtactttgatgtactcaaagagaagcctccggccccagaagct
gaggatgaggaagtagccaagaggctttgggctgaaagtgtccgcctggtgggcttggag
atgtcccatggatcccatgggaagaggggacagccgctccccaaataa

DBGET integrated database retrieval system