KEGG   Bos mutus (wild yak): 102272428
Entry
102272428         CDS       T02919                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bom03021]
    102272428 (AFF3)
Transcription machinery [BR:bom03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     102272428 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int BRD4_CDT
Other DBs
NCBI-GeneID: 102272428
NCBI-ProteinID: XP_005908785
Position
Un
AA seq 1092 aa
MVSHERGEDILNQRNDSLVVEFQSSASRCRSVYEPDRNVLRRKERERRNQEAQQDDGAFN
SSYSLFSEPYKTNKGDELSNRLQNTLGNYDEMKDFLTDRSNQSHLVGVPKPGVPQAPVTK
IDEHFVADSRAQTQPASVCSTTSSTPAAVPGQQSKRGTMGWQKAGHPPSDGQQRATQQGT
LRTLLGDGVGRQQPRTKQVCNVEVGLQTQDRPPAMGAKHSGNGHCVQNFPPSLASKPSLV
QQKPTAYVRPMDGQDQAPDESPKLKSSAETGVHCLYRGVPATKSESARAKAKLSKFSIPK
QGEESRSGETNSCVEEIIREMTWPPPLAAIQPPGKVEPSKFPFPNKDSQLASSGHNNPKK
GDAEPESPDNGTSNTSMLEDDLKLSSDEEENEQQAAQRTALHALSDSAGLQPADCRASAP
SSKGSSSGSSSSGSSSSSDSESSSGSDSETESSSSESEGSKPPHYSSPEAEPASSNKWQL
DKWLNKVNHHKPPVLIQNESHHGPESGQYYTPVKEDTQECGKLPDVCPPGLRDKDIKALG
ASTGVPPEPPKPRPCGNSRTNHRKELRSAVTCEKRRTRGLSRIVPKSKEFIETESSSSSS
SSDSDLESEQEAYPLSKAVAAAGGGPRAPVGSINARTTSDIAKELEEQFYTLVPFGRNEL
LSPLKDSDEVRSLWVKIDLTLLSRIPEHLPQEPGVLSAPAAKDSESAPPSHASEAPVEKT
LPKSKRKRKCDNEDDYREIKKAPGERESTSRLSASANSTLSANHCSMNINSLAIPINKNE
KVLRSPISPLSDASKHKFSGEDLTSSSRSNSNGLFTSTSSSKKHKAESQLQSHAADLTKA
AHNNSENILHKSRPQTEPWSPGSNGHRDCKRQKLIFDDMPRSADYFMQEAKRMKHKADAM
VEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMYSETVELIRYAMRLKTHSGPNAT
PEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIDYFKNSSKAAQAPSPWGASGKST
GTPSPMSPNPSPTGSVGSQGSLSNSNALSPSTIVSIPQRIHQMAANHVSITNSILHSYDY
WEMADNLAKENR
NT seq 3277 nt   +upstreamnt  +downstreamnt
atggtgtcccacgaaaggggtgaagacatcctaaaccagaggaatgactctctagttgtg
gagtttcagtcatcagccagcagatgcaggagtgtctacgaaccggatagaaacgtgtta
aggaggaaagaacgagaaagaagaaaccaggaagctcagcaggacgatggcgcatttaat
tcgagttactccctctttagtgaaccctacaagactaacaagggggatgagctctccaac
cggctccagaacactttaggcaattacgatgaaatgaaagactttctcacggatcgatca
aaccagagtcatcttgtgggtgttcccaaacctggggttcctcaggctcccgtgaccaag
attgatgaacattttgtggcagattcaagagcccagactcagccagcatcggtctgcagc
accacatcctccaccccagcagctgtccccgggcaacagagtaagcggggcaccatgggc
tggcagaaggctgggcacccgccatccgatggccaacagagagcaacacaacagggcact
ctcaggaccttgcttggcgatggcgttggcagacagcagccgcggaccaaacaggtgtgc
aatgtcgaggtgggtcttcagacccaggacaggccccctgctatgggagccaagcacagc
ggcaatggccactgcgtgcagaactttcctccctccctggcttcgaaacccagccttgtc
cagcagaagcctactgcctatgtgcggcccatggatggccaagatcaggcgcccgatgag
tctccgaagctaaagtcctctgcagagactggcgtgcactgcttgtacaggggtgtcccg
gccaccaagtcggagtcagccagagccaaggccaagctctccaagttcagcatccccaaa
caaggagaggagagtcgatctggagaaaccaacagctgtgttgaagaaatcattcgggag
atgacctggcctccaccacttgctgctattcaaccacctggcaaagtggaaccaagcaaa
tttccatttccaaataaggactctcagcttgcctcctctggacacaataatccaaagaaa
ggtgatgccgagccagagagtccagacaatggcacatcgaacacatcaatgctagaagat
gaccttaagctaagcagcgatgaagaggagaatgaacagcaggcagcccagagaacggcc
ctccatgctctgtctgacagtgccggactccagccggctgactgcagggcctccgcaccc
tcgagcaagggcagcagcagcggcagcagcagcagtgggagcagctcctccagcgactcg
gagagcagctcggggtccgactcggagacagagagcagttccagcgagagcgagggcagc
aagcctccccactactccagtcccgaggcggaaccagcgtcctctaacaagtggcagctg
gataaatggctaaacaaagtgaatcaccacaagccccctgtcctgatccaaaatgaaagc
caccacgggccggagagcggtcagtactacaccccagtgaaggaggacacgcaggagtgc
gggaagctccccgacgtctgcccgcccggcctgagagacaaggacatcaaggcgctgggg
gcgagcacgggggttcccccggagccccccaagccccggccttgcggcaacagcaggacc
aaccaccgcaaggagctgcgctcggccgtgacctgcgagaagcgccgcactcgggggctg
agccggatcgttcccaagtccaaggagttcatcgagacggagtcgtcctcttcctcctcc
tcctcggactcggacctggagtcggagcaggaggcctaccctctgtccaaggccgtggcc
gccgccggcggcggcccccgcgctcccgtgggctccatcaacgccaggaccaccagcgac
attgccaaggagctggaggagcagttctacacactggtccccttcggccgcaacgagctt
ctctccccgttgaaggacagtgacgaggtccggtcactctgggtcaaaattgacttgaca
cttctgtccaggatcccggaacacctgccccaggagccgggggtcttgagtgctcccgca
gccaaggactctgagagcgcgcccccgagccacgcatcggaggcgcccgtggaaaagacc
ttgccaaaatccaagaggaaacgcaagtgtgacaacgaagacgattacagggagatcaag
aaggccccgggagagagggagagcacctcacgactgagcgcctctgccaacagtactttg
tccgcaaatcattgcagcatgaacatcaacagcttggcaataccaataaataaaaatgaa
aaagtgctccggtcgcccatctcacccctctccgacgcatctaaacacaaattctccggc
gaggacttgacttcctccagcagatccaacagcaacggtctgttcacctccacctcctcc
agcaaaaagcataaggcagagagccagctgcagagccacgccgcggacctcacgaaagcg
gctcacaacaattccgaaaacattctccacaagtcacggccacagacagagccctggtct
ccaggctccaacggccaccgggactgcaagaggcagaaactcatcttcgatgatatgcca
cgcagtgcagattattttatgcaagaagctaagcgaatgaagcataaagcagatgcgatg
gtggaaaagtttggaaaggctctgaactatgcagaagcagccttgtcattcattgagtgt
ggaaatgccatggaacagggccccatggagtccaaatctccttacaccatgtattcagag
acagttgagctcatcaggtatgccatgagactaaaaacccactcaggtcccaatgccaca
ccagaggataaacagctggctgcattatgttaccgatgcctggctctcctgtactggagg
atgtttcgactcaaaagggatcacgctgtaaagtattcaaaagcacttatcgactatttc
aagaattcatctaaagctgcccaagccccatctccatggggggccagtggaaagagcact
gggaccccatcccccatgtctcccaatccgtcccccaccggctccgtgggctctcagggg
agcctgtccaacagcaacgccctgtccccatccaccatcgtcagcatcccgcagcgcatc
caccagatggcggccaatcacgtgagcatcaccaacagcattctccacagctacgactac
tgggagatggcagacaacctggccaaggaaaacagag

DBGET integrated database retrieval system