KEGG   Bos mutus (wild yak): 102272859Help
Entry
102272859         CDS       T02919                                 

Gene name
NSUN2
Definition
(RefSeq) NOP2/Sun RNA methyltransferase family member 2
  KO
K15335  tRNA (cytosine34-C5)-methyltransferase [EC:2.1.1.203]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bom03016]
    102272859 (NSUN2)
Enzymes [BR:bom01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.203  tRNA (cytosine34-C5)-methyltransferase
     102272859 (NSUN2)
Transfer RNA biogenesis [BR:bom03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    102272859 (NSUN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltr_RsmB-F FtsJ
Motif
Other DBs
NCBI-GeneID: 102272859
NCBI-ProteinID: XP_014334068
Position
Un
AA seq 721 aa AA seqDB search
MGALREPLPATLRITGYKSHAKEILHCLKNKYFKELEDLEVDGQKVEVPQPLSWYPEELA
WHTNLSRKILRKSPQLEKFHQFLVSETESGNISRQEAVSMIPPLLLNAHPHHKILDMCAA
PGSKTTQLIEMLHADMNVPFPEGFVIANDVDNRRCYLLVHQAKRLGSPCIMVVNHDASCI
PRLQVDVNGRKEILFYDRILCDVPCSGDGTMRKNVDVWKKWSALNSLQLHGLQLRIATRG
AEQLVEGGRMVYSTCSLNPIEDEAVIASLLEKSEGALELADVSSELPGLKWVPGLSQWKV
MTKDGQWFTSWDDVPHNRHTQIRPTMFPPKDPEKLQAMHLERCLRILPHHQNTGGFFVAV
LVKKASMPWNKRPPKLQGELAEPRAPVPPSPAEPMAGCTSDTSELESKLAPGISDTGAVE
RAENMDSSGSKRDGVCGPPPSKKMKLFGFKEDPFVFIPEDDPLFPPIQKFYALDPSFPKT
NLLTRTTEGKKRQLYMVSKELRNVLLNNSERMKVINTGIKVWCRNNSGEEFDCAFRLAQE
GIYTLYPFINSRIITVSIEDVQVLLTQENPFFRKLSSEAYSQVKDMAKGSVVLKYEPDPT
KPDTLQCPIVLCGWRGKASVRTFVPRNERLHYLRMMGLEVPVGKKREGAAAAPGAASPAE
AEDGPGGGRAAGRAVLTLQRSESGSAEKGLLAAWGLTALPTCSLGHCARPAGAAWPCQLI
R
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgctcagggagcctctcccggccactttaagaattaccggttacaagagccat
gcaaaagagattctccattgcttaaagaacaagtatttcaaggaactggaggacctggag
gtggatgggcagaaagttgaagttccacagcccttgagttggtatcctgaagaacttgcc
tggcacacaaatttaagtcgaaaaatcttgagaaagtctccacagctggaaaagtttcac
cagtttctggtcagcgaaactgaatctggaaacatcagccgtcaggaagccgtcagcatg
attccaccgctgttgctgaatgcccaccctcaccataagatcttagatatgtgtgcagct
ccagggtcaaagaccacacagttgattgaaatgctgcatgcggacatgaacgttcccttc
ccagagggctttgtcatcgccaacgacgtggacaacaggcggtgctacctgctggtgcac
caggccaagcggctgggcagcccctgcatcatggtggtcaaccacgacgcgtcctgcatc
ccgcgcctgcaggtggacgtcaacggcaggaaggagatcctcttctacgaccgcatcctc
tgtgatgtcccttgcagtggagatggcacaatgagaaaaaacgtcgacgtctggaagaag
tggagcgccttgaacagcctgcagctgcacggtttacagctacggatcgcaacacggggt
gctgagcagctagtggaggggggcaggatggtgtactctacgtgttcgctgaatcccatc
gaggatgaagccgtcatagcgtctctactggaaaagagtgaaggtgctttggagctcgcc
gacgtgtcttcagagttgccaggactgaagtgggtgcctgggctctcgcagtggaaggtg
atgacgaaagatgggcagtggttcacatcctgggacgatgtcccccacaacagacacacc
cagatccggccgaccatgttccccccgaaggaccctgagaagctccaggccatgcacctg
gagcgctgtcttagaatattaccacatcatcagaacactggaggcttctttgtggcggtg
ttggtgaagaaggcttcgatgccgtggaataagcgtcctccaaagctgcagggtgagctg
gcagagccgcgggcccccgtccccccaagccctgcggagcccatggcgggctgcacctct
gacacctcggagctggagagcaagctggcacctggcatcagcgacacaggagcagtggag
agagcggagaacatggacagcagtgggagtaagagggacggcgtgtgcggccctcctcca
tccaagaaaatgaagctgtttgggtttaaggaagatccctttgtgtttattcccgaagac
gacccgctgtttccacctatccagaagttttatgctttggatccctcgttcccaaagacg
aatctgttaacccgtaccacggaaggaaagaagaggcagctctacatggtgtccaaggag
ctgagaaacgtgctgctgaacaacagcgagaggatgaaggtcattaacactgggattaaa
gtctggtgtcgaaataacagcggtgaagagttcgactgtgctttccggttggcacaggag
ggaatatatacgttgtatccgtttattaactcaagaatcatcaccgtatcaatagaagac
gtccaagttctgttaacccaggaaaacccgttctttaggaagctcagcagcgaggcctac
agccaggtcaaggacatggccaagggcagcgtcgtcctgaagtatgagccggaccccacg
aagccggacacgctgcagtgccccatcgtgctgtgcggctggcgcggcaaggcctccgtg
cggactttcgtgcccaggaacgagcggctgcactacctgcgcatgatggggctggaggtg
ccggtgggaaagaagcgagagggcgccgctgcggcgcccggtgcggccagccccgcggag
gcggaagacgggccggggggggggagggccgccgggagggcggtgttgacgctgcagcgc
agtgagtctggctcggctgagaagggcctcttagcagcctggggactgacagcccttccg
acctgctccttggggcactgcgctcgcccggcaggtgccgcctggccgtgtcagttaatc
cgttaa

DBGET integrated database retrieval system