KEGG   Bos mutus (wild yak): 102272951Help
Entry
102272951         CDS       T02919                                 

Gene name
ZDHHC18
Definition
(RefSeq) zinc finger DHHC-type containing 18
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     102272951 (ZDHHC18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC HRG
Motif
Other DBs
NCBI-GeneID: 102272951
NCBI-ProteinID: XP_005895949
Position
Un
AA seq 253 aa AA seqDB search
MSCLLQTSFTDPGILPRATVCEAAALEKQIDNTGSSTYRPPPRTREVMINGQVVKLKYCF
TCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGKRNYRFFYAFILSLSFLTAFIFACV
VTHLTLRSQGSNFLSTLKETPASVLELVICFFSIWSILGLSGFHTYLVASNLTTNEDIKG
SWSNKRGGEASVNPYSHKSVITNCCAVLCGPLPPSLIDRRGFVQSDTVLPSPVRSDEPAC
GAKPDASMVGSHP
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcctgctgcagacaagtttcaccgaccctggaatcctgccccgggccacggtc
tgtgaggcagctgccctggagaaacagatcgacaacacaggcagttccacgtaccggcca
ccccctcggacccgggaggtgatgatcaacgggcaggtggtgaagctgaagtactgcttc
acctgtaagatgtttcggccgccccgcacctcacactgcagcgtctgcgacaactgtgtg
gaacggtttgaccatcactgcccctgggtgggcaactgtgtggggaaacggaactaccgc
ttcttctatgcattcattctctccctctcattcctgacggccttcatcttcgcctgtgtg
gtcacccacctgacgctgcgctctcagggaagcaacttcctctccactctgaaggagaca
ccagcgagcgtgctggagttggtgatctgcttcttctccatctggtccatcctgggcctc
tcagggtttcacacttacctcgtcgcctccaacctgacaactaatgaagatatcaaaggc
tcgtggtccaacaagaggggcggcgaggcctccgtcaacccctacagccataaaagtgtt
atcaccaactgctgtgctgtgctctgtggccccctacctcccagcctgattgaccggagg
ggatttgtgcagtccgacaccgtgttgccctcgcccgtcagaagcgacgagccagcctgc
ggagccaagcccgatgccagcatggtaggaagccacccatga

DBGET integrated database retrieval system