KEGG   Bos mutus (wild yak): 102273331Help
Entry
102273331         CDS       T02919                                 

Gene name
CD38
Definition
(RefSeq) CD38 molecule
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00760  Nicotinate and nicotinamide metabolism
bom01100  Metabolic pathways
bom04020  Calcium signaling pathway
bom04640  Hematopoietic cell lineage
bom04921  Oxytocin signaling pathway
bom04970  Salivary secretion
bom04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102273331 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102273331 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102273331 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102273331 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    102273331 (CD38)
   04972 Pancreatic secretion
    102273331 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bom04090]
    102273331 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:bom00536]
    102273331 (CD38)
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     102273331 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     102273331 (CD38)
CD molecules [BR:bom04090]
 Proteins
  102273331 (CD38)
Glycosaminoglycan binding proteins [BR:bom00536]
 Hyaluronan
  Cell surface receptors
   102273331 (CD38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse DUF3932
Motif
Other DBs
NCBI-GeneID: 102273331
NCBI-ProteinID: XP_005897691
Position
Un
AA seq 129 aa AA seqDB search
MRRNGVDEPLGTESRNCQAIRQAFMSAFISKDPCKATKEDYNSLINLAPPTVPCGQQVFW
SKTKELAHEYAKRRRLMTLEDTLLGYLADGLSWCGEPGSSDLNIWSCPDWRKDCRTNYVS
VFWEVLSER
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagacgcaatggtgtggatgaaccacttggcacagaaagcagaaactgccaagcgatc
aggcaggcattcatgagtgccttcatttccaaggatccctgcaaagcgacaaaggaagac
tacaactccctgatcaacctggcacctcccactgtgccttgtggccagcaagtcttctgg
agcaaaacgaaggagctggctcatgaatacgcgaaaaggcggcgcctgatgactctggag
gacacgctgctgggttaccttgcggatggcctcagctggtgtggagagccaggctcttct
gatttgaacatttggtcttgtccagactggaggaaagactgcagaaccaactatgtttct
gtattctgggaagtgctgtctgaaagg

DBGET integrated database retrieval system