KEGG   Bos mutus (wild yak): 102273894Help
Entry
102273894         CDS       T02919                                 

Gene name
HMGCS1
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA synthase 1
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00072  Synthesis and degradation of ketone bodies
bom00280  Valine, leucine and isoleucine degradation
bom00650  Butanoate metabolism
bom00900  Terpenoid backbone biosynthesis
bom01100  Metabolic pathways
bom03320  PPAR signaling pathway
Module
bom_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102273894 (HMGCS1)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    102273894 (HMGCS1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102273894 (HMGCS1)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    102273894 (HMGCS1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102273894 (HMGCS1)
Enzymes [BR:bom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     102273894 (HMGCS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 102273894
NCBI-ProteinID: XP_005894926
Position
Un
AA seq 520 aa AA seqDB search
MPGSLPLNAEACWPKDVGIVALEIYFPSQYVDQAELEKYDGVDAGKYTIGLGQAKMGFCT
DREDINSLCMTVVQNLMERNSLSYDCIGRLEVGTETIIDKSKSVKTNLMQLFEESGNTDI
EGIDTTNACYGGTAAVFNAVNWIESSSWDGRYALVVAGDIAVYATGNARPTGGVGAVAML
IGPNAPLIFERGLRGTHMQHAYDFYKPDMLSEYPIVDGKLSIQCYLSALDRCYSVYRKKI
RARWQKEGNDRDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA
FGDVKLEDTYFDRDVEKAFMKASSELFNQKTKASLLVSNQNGNMYTSSVYGSLASVLAQY
SPQQLAGKRIGVFSYGSGLAATLYSLKVTQDATPGSALDKIVASICDLKSRLDSRTCVAP
DIFAENMKLREDTHHLANYIPQSSIDSLFEGTWYLVRVDEKHRRTYARRPSLNDDTLNEG
VGLVHPSTTAEHIPSPAKKVPRLPATAAEPEAAVISNGEH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggtcgcttcctttgaatgcagaagcctgctggcccaaagatgtgggaattgtt
gcccttgagatctattttccttctcaatatgttgatcaagcagagttggaaaaatatgat
ggtgtagatgctggaaagtatactattggcttgggccaagccaagatgggcttctgcaca
gatagagaagatatcaactctctgtgcatgactgtggtccagaatcttatggagagaaat
agcctttcttatgactgcattgggcggctagaagttggaacggagacaatcatcgacaaa
tcaaagtcagtgaagacgaatttgatgcagctctttgaggagtctgggaatacggatata
gaaggaatagatacaactaatgcatgctatggaggcacggccgctgtctttaatgctgtt
aattggattgagtccagctcttgggatggacggtatgccctggtagttgcaggggatatt
gctgtatatgccacaggaaatgccagacctacaggtggggttggagccgttgctatgcta
attgggcctaatgcacctttaatttttgaacgaggacttcgtgggacacatatgcaacat
gcctatgacttttacaagcctgatatgctttctgaatatcctatagtagatggaaaactg
tccatacagtgctacctcagtgcattagaccgctgctattctgtctaccgcaagaagatc
cgtgcccggtggcagaaagagggaaatgatagagatttcaccttgaatgattttggtttc
atgatattccactcaccctattgtaaactggttcagaaatctctagctcggatgttgctg
aatgacttccttaatgaccagaacagagataagaatagtatctacagtggcctagaagcc
tttggggatgttaaattagaagatacctactttgacagagatgtggaaaaggcatttatg
aaagctagttcagaactcttcaatcagaaaacaaaggcatctttgcttgtgtcaaatcaa
aatggaaatatgtacacatcttcagtgtacggctccctggcttctgttctcgcacagtac
tcacctcagcagctggcaggaaagaggatcggcgtgttttcttacggttctggtttggct
gccactctgtactccctcaaagttacacaagatgccacaccagggtctgctcttgataaa
atagtagcaagcatatgtgatcttaagtcaaggcttgactcaagaacttgtgtggcacca
gatatttttgctgaaaacatgaagctccgagaggatactcatcacttggccaactacatt
ccccagagttccatagattccctcttcgaaggaacatggtacctagttcgagtagacgaa
aaacacagaagaacttacgctcggcgcccgtctctaaacgacgacactttgaatgaggga
gtaggccttgtgcacccaagcactacagccgagcatattccaagccctgctaagaaagtg
ccaagactccctgcaacagcagcagaacctgaagcagctgtcatcagtaacggggagcat
taa

DBGET integrated database retrieval system