KEGG   Bos mutus (wild yak): 102273898Help
Entry
102273898         CDS       T02919                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock protein family A (Hsp70) member 8
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bom  Bos mutus (wild yak)
Pathway
bom03040  Spliceosome
bom04010  MAPK signaling pathway
bom04141  Protein processing in endoplasmic reticulum
bom04144  Endocytosis
bom04213  Longevity regulating pathway - multiple species
bom04612  Antigen processing and presentation
bom04915  Estrogen signaling pathway
bom05134  Legionellosis
bom05145  Toxoplasmosis
bom05162  Measles
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102273898 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102273898 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102273898 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102273898 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102273898 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102273898 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    102273898 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102273898 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    102273898 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102273898 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102273898 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bom03041]
    102273898 (HSPA8)
   03009 Ribosome biogenesis [BR:bom03009]
    102273898 (HSPA8)
   03110 Chaperones and folding catalysts [BR:bom03110]
    102273898 (HSPA8)
   04131 Membrane trafficking [BR:bom04131]
    102273898 (HSPA8)
   03051 Proteasome [BR:bom03051]
    102273898 (HSPA8)
   03029 Mitochondrial biogenesis [BR:bom03029]
    102273898 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102273898 (HSPA8)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102273898 (HSPA8)
Spliceosome [BR:bom03041]
 Complex B
  Other components
   Prp19 complex
    102273898 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    102273898 (HSPA8)
Ribosome biogenesis [BR:bom03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102273898 (HSPA8)
Chaperones and folding catalysts [BR:bom03110]
 Heat shock proteins
  HSP70 / DNAK
   102273898 (HSPA8)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102273898 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102273898 (HSPA8)
Proteasome [BR:bom03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102273898 (HSPA8)
Mitochondrial biogenesis [BR:bom03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102273898 (HSPA8)
Exosome [BR:bom04147]
 Exosomal proteins
  Proteins found in most exosomes
   102273898 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 102273898
NCBI-ProteinID: XP_014333782
Position
Un
AA seq 656 aa AA seqDB search
MKVPERCATMSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLI
GDAAKNQVAMNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGET
KSFYPEEVSSMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLR
IINEPTAAAIAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGE
DFDNRMVNHFIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGI
DFYTSITRARFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQ
DFFNGKELNKSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSXTAGGVMTVLI
KRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQI
EVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRD
KVSSKNSLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEH
QQKELEKVCNPIITKLYQSAGGMPGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttccagaacgctgcgcaaccatgtctaaaggacctgcagttggcattgatctt
ggcaccacctattcttgtgtgggtgtcttccagcacggaaaggtggaaataattgccaat
gatcaggggaaccgaaccaccccaagctatgtcgcctttactgataccgaacggttaatc
ggtgatgcagcaaagaaccaagtcgcaatgaatcccaccaacacggtttttgatgccaaa
cgacttattggacgaagatttgatgatgctgttgtccagtctgatatgaaacattggccc
ttcatggtggtgaatgatgctggcaggcctaaggttcaagtagaatacaagggagagaca
aagagtttttacccagaggaggtgtcatccatggtcctgacaaagatgaaggaaatcgca
gaagcctaccttgggaagacggttaccaacgctgtcgtcacagtacctgcctattttaat
gactctcagcgtcaggctaccaaagatgctggaactattgctggtctcaacgtacttcga
atcatcaatgagccaactgctgctgctattgcctatggcttagacaaaaaggttggagca
gaaagaaatgtgctgatctttgatttaggtggtggcacttttgatgtgtcaatcctcact
attgaggatggaatctttgaggtcaaatctacagctggagatacccacttgggtggagaa
gactttgacaaccgcatggttaaccattttattgcagagttcaagcgtaaacacaagaag
gatatcagtgaaaacaagagggctgtccgtcgcctccgtactgcttgtgagcgtgctaag
cgcactctctcttccagcacccaggccagtattgagattgattccctctatgaaggaatc
gacttctatacctctattacccgtgcccgatttgaagaattgaatgctgacttgttccgt
ggcaccctggaccctgtggagaaagcccttagggatgccaaactggacaagtctcagatt
catgatattgtcttggttggtggctcaacccgtatccccaagattcagaaacttctccag
gacttcttcaacgggaaagaactgaataagagcatcaaccctgatgaggctgttgcatat
ggtgcagctgtccaggcagccattttgtctggagacaaatctgaaaatgttcaagacttg
ctgctgttggatgtcactcctctttccnaaactgctggtggagtcatgactgtcctcatc
aagcgcaataccaccattcctaccaagcagacgcagactttcaccacctactctgacaac
cagcctggtgtgctcattcaggtttatgaaggtgagcgtgccatgaccaaggataacaac
ctgcttggcaagtttgaactcacgggcatacctcctgccccccgtggtgttcctcagatt
gaagtcacttttgatattgatgccaatggcatcctcaatgtttctgctgtggataagagc
acaggaaaagagaacaagattaccatcactaatgacaagggccgcttgagcaaggaagac
attgaacgcatggttcaagaagcagagaagtacaaagctgaagatgagaagcagcgggac
aaggtgtcttcaaagaattcgcttgaatcctacgccttcaacatgaaagctactgttgag
gatgagaaacttcagggcaagattaatgatgaagacaaacagaagattcttgacaagtgt
aatgaaataatcaactggctggataagaaccagactgcagagaaggaagaatttgaacat
cagcagaaggagctggaaaaagtctgcaaccccatcattaccaagctgtaccagagtgca
ggaggcatgcctgggggaatgccaggaggaatgcctgggggcttccctggtggtggagct
cctccatcaggtggtgcctcctctgggcccaccattgaagaggttgattaa

DBGET integrated database retrieval system