KEGG   Bos mutus (wild yak): 102274461Help
Entry
102274461         CDS       T02919                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01521  EGFR tyrosine kinase inhibitor resistance
bom01522  Endocrine resistance
bom01524  Platinum drug resistance
bom04012  ErbB signaling pathway
bom04014  Ras signaling pathway
bom04015  Rap1 signaling pathway
bom04024  cAMP signaling pathway
bom04062  Chemokine signaling pathway
bom04066  HIF-1 signaling pathway
bom04068  FoxO signaling pathway
bom04070  Phosphatidylinositol signaling system
bom04071  Sphingolipid signaling pathway
bom04072  Phospholipase D signaling pathway
bom04140  Autophagy - animal
bom04150  mTOR signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04152  AMPK signaling pathway
bom04210  Apoptosis
bom04211  Longevity regulating pathway
bom04213  Longevity regulating pathway - multiple species
bom04218  Cellular senescence
bom04360  Axon guidance
bom04370  VEGF signaling pathway
bom04380  Osteoclast differentiation
bom04510  Focal adhesion
bom04550  Signaling pathways regulating pluripotency of stem cells
bom04611  Platelet activation
bom04620  Toll-like receptor signaling pathway
bom04625  C-type lectin receptor signaling pathway
bom04630  Jak-STAT signaling pathway
bom04650  Natural killer cell mediated cytotoxicity
bom04660  T cell receptor signaling pathway
bom04662  B cell receptor signaling pathway
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04668  TNF signaling pathway
bom04670  Leukocyte transendothelial migration
bom04722  Neurotrophin signaling pathway
bom04725  Cholinergic synapse
bom04750  Inflammatory mediator regulation of TRP channels
bom04810  Regulation of actin cytoskeleton
bom04910  Insulin signaling pathway
bom04914  Progesterone-mediated oocyte maturation
bom04915  Estrogen signaling pathway
bom04917  Prolactin signaling pathway
bom04919  Thyroid hormone signaling pathway
bom04923  Regulation of lipolysis in adipocytes
bom04926  Relaxin signaling pathway
bom04930  Type II diabetes mellitus
bom04931  Insulin resistance
bom04932  Non-alcoholic fatty liver disease (NAFLD)
bom04933  AGE-RAGE signaling pathway in diabetic complications
bom04960  Aldosterone-regulated sodium reabsorption
bom04973  Carbohydrate digestion and absorption
bom05100  Bacterial invasion of epithelial cells
bom05142  Chagas disease (American trypanosomiasis)
bom05146  Amoebiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05166  HTLV-I infection
bom05167  Kaposi's sarcoma-associated herpesvirus infection
bom05169  Epstein-Barr virus infection
bom05200  Pathways in cancer
bom05203  Viral carcinogenesis
bom05205  Proteoglycans in cancer
bom05210  Colorectal cancer
bom05211  Renal cell carcinoma
bom05212  Pancreatic cancer
bom05213  Endometrial cancer
bom05214  Glioma
bom05215  Prostate cancer
bom05218  Melanoma
bom05220  Chronic myeloid leukemia
bom05221  Acute myeloid leukemia
bom05222  Small cell lung cancer
bom05223  Non-small cell lung cancer
bom05224  Breast cancer
bom05225  Hepatocellular carcinoma
bom05226  Gastric cancer
bom05230  Central carbon metabolism in cancer
bom05231  Choline metabolism in cancer
bom05418  Fluid shear stress and atherosclerosis
Module
bom_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102274461 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102274461 (PIK3CD)
   04015 Rap1 signaling pathway
    102274461 (PIK3CD)
   04012 ErbB signaling pathway
    102274461 (PIK3CD)
   04370 VEGF signaling pathway
    102274461 (PIK3CD)
   04630 Jak-STAT signaling pathway
    102274461 (PIK3CD)
   04668 TNF signaling pathway
    102274461 (PIK3CD)
   04066 HIF-1 signaling pathway
    102274461 (PIK3CD)
   04068 FoxO signaling pathway
    102274461 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    102274461 (PIK3CD)
   04072 Phospholipase D signaling pathway
    102274461 (PIK3CD)
   04071 Sphingolipid signaling pathway
    102274461 (PIK3CD)
   04024 cAMP signaling pathway
    102274461 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    102274461 (PIK3CD)
   04152 AMPK signaling pathway
    102274461 (PIK3CD)
   04150 mTOR signaling pathway
    102274461 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    102274461 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    102274461 (PIK3CD)
   04218 Cellular senescence
    102274461 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    102274461 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    102274461 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    102274461 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102274461 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    102274461 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    102274461 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    102274461 (PIK3CD)
   04660 T cell receptor signaling pathway
    102274461 (PIK3CD)
   04662 B cell receptor signaling pathway
    102274461 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    102274461 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    102274461 (PIK3CD)
   04670 Leukocyte transendothelial migration
    102274461 (PIK3CD)
   04062 Chemokine signaling pathway
    102274461 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    102274461 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    102274461 (PIK3CD)
   04915 Estrogen signaling pathway
    102274461 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    102274461 (PIK3CD)
   04917 Prolactin signaling pathway
    102274461 (PIK3CD)
   04926 Relaxin signaling pathway
    102274461 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    102274461 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102274461 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    102274461 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    102274461 (PIK3CD)
   04722 Neurotrophin signaling pathway
    102274461 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102274461 (PIK3CD)
  Development
   04360 Axon guidance
    102274461 (PIK3CD)
   04380 Osteoclast differentiation
    102274461 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    102274461 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    102274461 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102274461 (PIK3CD)
   05230 Central carbon metabolism in cancer
    102274461 (PIK3CD)
   05231 Choline metabolism in cancer
    102274461 (PIK3CD)
   05205 Proteoglycans in cancer
    102274461 (PIK3CD)
   05203 Viral carcinogenesis
    102274461 (PIK3CD)
   05210 Colorectal cancer
    102274461 (PIK3CD)
   05212 Pancreatic cancer
    102274461 (PIK3CD)
   05225 Hepatocellular carcinoma
    102274461 (PIK3CD)
   05226 Gastric cancer
    102274461 (PIK3CD)
   05214 Glioma
    102274461 (PIK3CD)
   05221 Acute myeloid leukemia
    102274461 (PIK3CD)
   05220 Chronic myeloid leukemia
    102274461 (PIK3CD)
   05218 Melanoma
    102274461 (PIK3CD)
   05211 Renal cell carcinoma
    102274461 (PIK3CD)
   05215 Prostate cancer
    102274461 (PIK3CD)
   05213 Endometrial cancer
    102274461 (PIK3CD)
   05224 Breast cancer
    102274461 (PIK3CD)
   05222 Small cell lung cancer
    102274461 (PIK3CD)
   05223 Non-small cell lung cancer
    102274461 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102274461 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102274461 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102274461 (PIK3CD)
   04931 Insulin resistance
    102274461 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    102274461 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    102274461 (PIK3CD)
   05166 HTLV-I infection
    102274461 (PIK3CD)
   05162 Measles
    102274461 (PIK3CD)
   05164 Influenza A
    102274461 (PIK3CD)
   05161 Hepatitis B
    102274461 (PIK3CD)
   05160 Hepatitis C
    102274461 (PIK3CD)
   05163 Human cytomegalovirus infection
    102274461 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102274461 (PIK3CD)
   05169 Epstein-Barr virus infection
    102274461 (PIK3CD)
   05165 Human papillomavirus infection
    102274461 (PIK3CD)
   05146 Amoebiasis
    102274461 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    102274461 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    102274461 (PIK3CD)
   01524 Platinum drug resistance
    102274461 (PIK3CD)
   01522 Endocrine resistance
    102274461 (PIK3CD)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     102274461 (PIK3CD)
Membrane trafficking [BR:bom04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    102274461 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_rbd PI3K_C2 PI3K_p85B DOCK-C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 102274461
NCBI-ProteinID: XP_005892789
Position
Un
AA seq 1013 aa AA seqDB search
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKFHMLSDPEAYVFT
CVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSL
QDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGPGTLRVPNRVLL
VNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGKHEYLY
GSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRTKPPPIPMKKP
SSVSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSSSEVSVCSEPVW
KQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQ
LKTGEHCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAPHPVYYPSLDKI
LELGRLGEHGRFTEEEQLQLRESLERRGXGRSLEPDAARTPALTARILLQMLYLLCSWPE
LPVLSALELLDFSFPDRHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFK
NLLDRALANRRIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSK
LKALNDVVKVSSQKTTKPQTKELMHLCMRQETYLEALSHLQSPLDPSTLLAEVCVEQCTF
MDSKMKPLWVMYSNEEAGSDGTVGIIFKNGDDLRQDMLTLQMIQLMDILWKQEGLDLRMT
PYGCLSTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRA
IEEFTLSCAGYCVATYVLGIGDRHSDNIMIRENGQLFHIDFGHFLGNFKTKFGINRERVP
FILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSC
SKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaacgtg
gcagttgatttcttgctccccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaagttccacatgctcagtgaccctgaggcctacgtgttcacc
tgcgtcaaccagacggcggagcagcaggagctggaggacgagcagcggcggctctgcgac
atccagcccttcctgcccgtcctgcggctggtggcccgcgagggtgaccgcgtgaagaag
ctcatcaactcgcagatcagcctgctcatcggcaaaggcctccacgagtttgactccttg
caagacccggaggtgaatgacttccgaggcaagatgcgccagttctgcgaggaggcggct
gcccgcaggcagcagctgggctgggaggcctggctgcagtacagcttccctctgcagttg
gagccctcggcgcggagctgggggccaggcaccctgcgcgtccccaatcgggtcctcctg
gtcaatgtcaagtttgagggcagcgaggagagcttcaccttccaggtatccaccaaggat
gtgcccctggcactgatggcctgtgccctccgaaagaaggccacggtgttccggcagccg
ctggtggagcagcctgaggactacacgctgcaggtgaacggcaagcacgagtacctgtac
ggcagctaccccctctgccagttccagtacatctgcagctgcctgcacagtgggctgacc
ccgcacctgaccatggtgcactcctcctccatcctcgccatgcgggacgagcagagcaac
cccgccccccaagtccagaagccacgcaccaaaccaccccccatccccatgaagaagccc
tcctctgtgtccctctggtccctggagcagcctttctacatcgagctgatccagggcagc
aaagtgaatgccgacgagcggatgaagctggtggtgcaggccgggctcttccatggcaat
gagacgctatgcaagacggtgtccagctcggaggtgagcgtgtgctcggagcccgtgtgg
aagcagcggctggagtttgacatcaacatctgtgacctgccccgcatggcccggctctgc
ttcgcgctttacgctgtgatcgagaaggccaagaaggcccgctccaccaagaagaagtcc
aagaaggcggactgccccattgcctgggccaacctcatgctgtttgactacaaggaccag
ctcaagacgggcgagcactgtctctatatgtggccctctgtcccagacgagaaaggggaa
ctactgaacccctgtgggaccgtgcggagtaaccccaacactgagagtgcagccgccctg
gtcatctttctccctgaggtggcccctcaccctgtatactacccttccctggacaagatc
ctggagctggggcggcttggagagcatggacgcttcacggaggaggagcagctgcagctg
cgggagagcctggagcggcggggnnaggggcggagcctggagccagacgcagcccgcacc
cccgccctgaccgctcgcatcctcctccagatgctctacctgctctgctcctggcctgaa
ctgcccgttctgagcgccctggagttgctagacttcagcttccccgaccgccacgtggga
tccttcgccatcaagtccctgcggaaactaacggacgacgagcttttccagtacctgctg
cagctggtgcaggtgctcaagtacgagtcctacctcgactgcgagctgaccaaattcaaa
aacctgctggaccgggccctggccaatcgcaggatcggccacttcctcttctggcacctc
cgctccgagatgcacgtgccgtcggtggccctgcgcttcggccttatcatggaagcctat
tgccggggcagcactcaccacatgaaagtgctgatgaagcagggggaagcactgagcaaa
ctgaaggccctgaacgacgtcgtcaaagtgagctcccagaagaccaccaagccccagacc
aaggagctgatgcacctgtgcatgcgccaggagacctacctggaggccctctcccacttg
cagtccccactcgaccccagcaccctgctggctgaagtctgcgtggagcagtgcaccttc
atggactccaagatgaaacccctgtgggtcatgtacagcaacgaggaggcaggcagcgac
ggcaccgtgggcatcatctttaagaatggggacgacctccgccaggacatgctgaccctg
cagatgatccagctcatggacattctgtggaagcaggagggcttggacctgaggatgacc
ccctacggctgcctctccactggggaccgcacaggccttatcgaggtggtgcttcactcg
gacaccattgccaacatccagctgaacaagagcaacatggcggccacggctgccttcaat
aaggatgctctgctcaactggctcaagtccaagaaccctggggaggccctggatcgagcc
attgaggagttcaccctctcctgtgctggctactgtgtggctacctatgtgctgggcatt
ggcgatcgtcacagcgacaacatcatgatccgagagaacgggcagctgttccacattgat
ttcggccactttctggggaatttcaagaccaagtttggaatcaaccgtgagcgggtcccg
ttcatcctcacctatgactttgtccacgtgatccagcaagggaagacgaataatagtgag
aagtttgaaaggttccggggctactgtgagagggcctacaccatcctgcggcgccatggg
ctccttttcctccacctctttgccctgatgcgggcggcaggcctgcctgagctcagctgc
tccaaagacatccagtatctcaaggattctctggcattggggaaaacggaggaggaggct
ctgaagcacttccgagtgaagtttaatgaagccctccgggaaagctggaaaaccaaagtg
aattggctggcccacaacgtgtccaaagataacaggcaataa

DBGET integrated database retrieval system