KEGG   Bos mutus (wild yak): 102274558Help
Entry
102274558         CDS       T02919                                 

Gene name
HRH2
Definition
(RefSeq) histamine receptor H2
  KO
K04150  histamine receptor H2
Organism
bom  Bos mutus (wild yak)
Pathway
bom04020  Calcium signaling pathway
bom04080  Neuroactive ligand-receptor interaction
bom04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    102274558 (HRH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102274558 (HRH2)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    102274558 (HRH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bom04030]
    102274558 (HRH2)
G protein-coupled receptors [BR:bom04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    102274558 (HRH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 102274558
NCBI-ProteinID: XP_005893243
UniProt: L8IRW0
Position
Un
AA seq 370 aa AA seqDB search
MAANGTASSSCLDPTAFKVTVTVVLILLILITIAGNVVVCLAVGLNRRLRSLTNCFIVSL
AITDLLLGLLVLPFSAFYQLSCQWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV
TDPLRYPVLVTPVRVAVSLVLIWVISITLSFLSIHLEWNSRPENHSDSHTIPKCKVQVNL
VYGLVDGLVTFYLPLLVMCITYYRIFRIAREQARRIHNVGPWRAATLREHKATVTLAAVM
GAFIVCWLPYFTVFVYRGLRGDSAVDKTVEDVVLWLGYANSALNPVLYAALNRDFRTAYQ
QLFRCSPAGQDARRTSLGSNSSQLVRHPGQGPRWPEERPLRLQVWSGTELTAPQGATDRP
CLCPPECWSV
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaatggcacagcctcatcctcttgtctggatcccaccgcgttcaaggtcacc
gtcaccgtagtcctcatcctcctcatcctcatcaccatcgccggcaatgtggtcgtctgc
ctggcggtgggcttgaaccgccggctccgcagcctgaccaactgcttcattgtgtccctg
gccattactgacctgctcctcggcctcctggtgctgcccttctctgccttctaccagctg
tcctgccagtggagctttggcaaggtcttctgcaacatctataccagcctggatgtcatg
ctctgcacggcctccatcctcaacctcttcatgatcagccttgacaggtactgcgcagtc
acagaccccctgcgctaccccgtgctggtcaccccggtccgggtcgccgtctccctggtc
ttaatctgggtcatttccatcaccctgtccttcctgtccatccacctggaatggaacagc
aggcctgagaaccacagtgacagtcacaccatccccaagtgcaaagtccaggtcaacttg
gtgtacggtctggtagacgggctggtcaccttctacctgccgctgctcgtcatgtgcatt
acgtactaccgcatcttcaggatcgcccgggaacaggccaggaggattcacaacgtcggc
ccgtggagggcagccacgctcagggagcacaaagccacggtgacgctggctgccgtcatg
ggggccttcatcgtctgctggctcccctacttcaccgtgttcgtttaccgggggctgcga
ggggacagcgctgtcgacaagaccgtggaagacgtggtcctgtggctgggctatgccaac
tcggccctgaaccccgtgctgtacgccgcgctcaacagagacttccgcacggcctaccag
cagctcttccgctgcagccccgccggccaggacgcgcgcaggacttctctggggtccaac
agctctcagctggtgaggcatccgggccagggacccaggtggccggaagagaggcccctg
aggctccaggtgtggagtgggactgagctcacggccccccagggagccacagacagacca
tgcctttgccccccagaatgctggtctgtgtga

DBGET integrated database retrieval system