KEGG   Bos mutus (wild yak): 102274955
Entry
102274955         CDS       T02919                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchoring protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102274955 (AKAP5)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     102274955 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 102274955
NCBI-ProteinID: XP_005898312
UniProt: L8IDL5
Position
Un
AA seq 429 aa
MEITVSEIQVESKDETRSAEVRPQDERQEEKASMLCFKRRKKAAKAMKPKASSKAADAAK
KCPPEARRASDQPQRPGGAWDSIKRLVTRRKRSESSKQQKPFKAKLQSEINAEDANPSKK
KAKSRLKIPCIKFSKGEKRSNHSKIIEDSDRSVKVQEAENLVTKTQTQSDDQATKSKSPQ
DVREDVSQKGDDEVCESNVNNSITSPGEKVISVELELDMGHSAIQTGTLILEKDTEMLEE
KQSIQPQHVSPLEASDTEQELPVGSEVPPSSAVPDQQILEEARNGVLESGPDWKEHESRE
IVVEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNV
PKPFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASD
DNTINNRLQ
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacctcaggatgagaggcaggaggaaaaagcatcgatgctctgcttcaagagaaga
aaaaaagcagccaaagcaatgaagcccaaagccagctctaaagctgctgatgcagcaaag
aagtgtcctccagaagcacgacgagcttctgatcagccacagcgccctggcggggcctgg
gactcaatcaaacgccttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaag
ccctttaaggctaaactgcaatctgaaatcaatgctgaggatgctaatccttctaagaaa
aaggcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagt
aatcactccaaaatcatagaagactcagaccgcagtgtcaaagtccaagaggctgaaaat
ctggttacaaaaactcagacccaatcagatgaccaggcaacaaagagcaagtcgccccag
gatgtaagggaagatgtctcacagaaaggggacgatgaggtctgtgaatcaaatgtgaac
aacagcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggt
cattctgctattcaaacaggaactctaatccttgaaaaagatactgaaatgcttgaggaa
aaacaaagcattcaacctcagcacgtgagcccattggaagcttcggacacagaacaggag
ctcccagtgggttctgaagttcctccctcatctgcagtcccagatcaacaaattctggaa
gaagccagaaatggtgtcctagaaagtggaccagattggaaggagcatgaaagtagagag
attgttgttgaggagagtaagccaaaagatactgaattgagccaggaattggattttcaa
gaaaatgagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaatt
gctattattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtc
cctaagccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagt
ggttttgagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttct
cttgtcaagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgat
gataatacaataaacaatcgtctacagtga

DBGET integrated database retrieval system