KEGG   Bos mutus (wild yak): 102275589Help
Entry
102275589         CDS       T02919                                 

Gene name
KDM4D
Definition
(RefSeq) lysine demethylase 4D
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102275589 (KDM4D)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     102275589 (KDM4D)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     102275589 (KDM4D)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    102275589 (KDM4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN PGBA_N
Motif
Other DBs
NCBI-GeneID: 102275589
NCBI-ProteinID: XP_005910311
UniProt: L8HPA8
Position
Un
AA seq 500 aa AA seqDB search
MEAMKPSCAQNPSCSIMIFHPTKEEFTDFDKYIAYIESQGAHRAGLAKIVPPKEWKARQT
YDDIDDILIAAPLQQVVSGRAGVFTQYHKKKKAMTVAEYRHLANTEKYQTPFYSDFEELE
RKYWKTRLFESPVYGADISGSLFDENTKQWNLGRLGTIQDLLEQECGVVIEGVNTPYLYF
GMWKTAFAWHTEDMDLYSINFLHFGEPKTWYAVPPEHGRRLERLASALFPGSSRGCEAFL
RHKAALISPTVLRDNGIPFGRVTQEAGEFMVTFPYGYHSGFNHGFNCAEAINFATPRWID
YGKVASQCSCGEAQVAFSMDAFVRILQPERYELWKRGQDRAVVNHAEPAAPGGQELRAWK
EVQTLGPKYFPPRRTARLRQPVSSSEGTDPRAPVRAVSLRPLPARGSCSASQFDAVAGSS
SRKPSQTPPLLPGPSVASCLHPVGRCGSRRRPQEKSTQELTAPIGAKRGLALDRKAQDPK
AQPLSAEGRIDNPAPTIPGL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatgaagcccagttgtgctcagaacccaagttgtagcataatgatatttcat
ccaaccaaagaagagtttactgattttgataaatacattgcttacatagaatcgcaaggg
gcccaccgagcaggcttggctaagatagtgccacccaaggaatggaaagccagacagacc
tacgacgatatcgatgacatcttaatagccgctccgctccagcaggtggtctctgggcgg
gcaggtgtgtttactcaataccacaaaaagaagaaagccatgaccgtggcagagtaccgc
cacttagcaaatactgaaaaataccagactccattctactccgattttgaggaattggag
cgaaaatattggaaaacccgcctctttgagtccccagtatacggcgcggacatcagtggc
tctttatttgatgaaaacacgaagcagtggaacctgggacgcctggggaccatccaggac
ctgctggagcaggagtgcggggtggtcatcgagggcgtcaacaccccctacctgtacttc
ggcatgtggaagaccgccttcgcctggcacacggaggacatggacctttacagcatcaac
ttcctgcacttcggggagcctaagacctggtacgcggtgccacccgagcacggccggcgc
ctggaacgcctggccagcgcgctcttcccgggcagctcgaggggctgcgaggccttcctg
cgccacaaggcggcgctcatctcgcccacggtgctccgggacaatggcatccccttcggt
cgggtcacgcaggaggcgggcgagttcatggtgaccttcccctacggctaccactcgggc
ttcaaccacggcttcaactgcgccgaggccatcaatttcgccaccccgcgctggatcgat
tatggcaaagtggcctcgcagtgcagctgcggcgaggcgcaggtggccttctccatggac
gccttcgtgcgcatcctgcagcccgagcgctatgagctgtggaagcgcgggcaggaccgg
gcggtggtgaaccacgccgagcccgcggcgccgggcggccaggagctgagagcctggaag
gaggtgcagacgctgggccccaagtacttcccgcctcgccgcaccgcccgcctgcgtcag
cccgtgtcctcaagcgagggcactgacccaagagcccctgtgcgggccgtgtccctgcga
cccttgcctgcccggggttcctgctcggcttcccagtttgacgctgtcgccggcagcagc
tcacggaagcccagccagacccctccgctgttgccaggtccgtcggtggcgtcgtgcctc
cacccagttggcagatgtggttctcgtcgtcgccctcaggaaaaaagcactcaagagctg
actgcccccattggagctaagaggggccttgccttagaccgcaaggctcaggaccccaag
gctcaacccctgtctgcagagggacggatagacaatcctgccccaacgatccctggactc
tag

DBGET integrated database retrieval system