KEGG   Bos mutus (wild yak): 102276152Help
Entry
102276152         CDS       T02919                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00260  Glycine, serine and threonine metabolism
bom01100  Metabolic pathways
bom01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102276152
Enzymes [BR:bom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     102276152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 102276152
NCBI-ProteinID: XP_014338639
Position
Un
AA seq 303 aa AA seqDB search
MANLISVMCHCRRRGSQLLLGHECHLHVYEQGGVAQIAGVHSHPLPDLPHGTLDLAELER
LVTRGLGSPYHPVCELICLENTHSSSGGRVLPMEYLRQVHLLARRYGVRVHLDGARLMNA
AVALGVPPACIVEHCDSVSLCFSKGLGAPVGALVGGPKDFIEEAWRLRKALGGGMRQAGV
LAAAALVGLADAEEMLQRDHQNAQRFARGLQELASPVCSVDPTAVETNMVMVRVDGLPPE
ELCRRLQAVSADEVAQTGRAVRVLLFPWAERSVRAVWHRDVSAQDTELALGKWAFVLRTL
RTG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccaacctcatctctgtgatgtgtcactgccggcgccggggctcccagctcctcctg
gggcacgaatgccacctccatgtctatgagcagggcggggtggctcagatcgcaggggtg
cactcccaccccctcccagacctgccccacggcaccctggacctggctgagctggagagg
ctggtcacacggggccttgggagcccctaccacccggtctgtgagctcatttgcctggag
aacacccacagcagctcggggggccgggtcctccccatggaatacctacgccaggtgcac
ttgctggcccgacgctatggggtccgcgtccacctggacggggcgcggttgatgaacgct
gcggtggctctgggcgtgccccctgcctgcatcgtggagcactgcgactctgtgtctctc
tgtttttccaagggcctcggtgcaccagtgggggccctggttgggggacccaaggacttc
attgaagaagcctggcgcctccggaaagccctgggtggagggatgcgccaggcaggggtg
ctggccgcagctgccctggtgggactggctgacgccgaggagatgctgcagagggaccac
cagaatgcccagagattcgccagagggctccaggaactggcgtcccctgtctgctccgtg
gatcccactgccgtggagaccaacatggtgatggtgagggtggacgggctgccgccggag
gagctgtgccggcgcctgcaggccgtgagcgcagacgaggtggcccagactggccgtgcg
gtgcgcgtgctgctcttcccctgggctgagcggtcagtgcgcgctgtgtggcaccgggac
gtctctgcgcaggacacggagctggcactgggaaagtgggcgttcgtgctgaggaccctg
cggacggggtga

DBGET integrated database retrieval system