KEGG   Bos mutus (wild yak): 102276252
Entry
102276252         CDS       T02919                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bom03036]
    102276252 (ANKRD53)
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    102276252 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_3 Ank_4
Other DBs
NCBI-GeneID: 102276252
NCBI-ProteinID: XP_005891813
Position
Un
AA seq 538 aa
MPSLQDAWAVGWGNQLVGDPAREARRSRPSTTPLVRECLPASARSASWHFVRWAAAAAPI
RRRYLSGDVHLQLAKKGSTTRKESAVRRRSSMSLAEEWDQRAMGGSYYQLFAASLGNLEW
LRFCLNRHRGEILADDKGFTAIHFAAQSGKLACLQVLVEEYKFPVNLPTNNGQTPLHLVI
HGDNKTVALACIHYLIKQGAALNTQTCNGSTPLHLAAREGLLSCVKVLVQKGANVHAQDA
TGCKPIDYCKIWNHRVCARFLKDAMWKRDKEDFAHEMRKLKRLKDQLALMEEDYLTEYQK
EHQILREADFKKWLHHKLLLQDQSLIPSVQREPRAPPRATALSKTCKDGVLWPPTSFHPS
PEARLQQIQQPNLPLVMSVPTYKPPTIRRPKVWNLSSNPTRSPTAQIGYPQGVRLGVHPD
PRPERDFRCFVEVRSDGHGGAHLRTVAGRQVAPVPRLPFEVVIRELHPSVRPYRMKVPQD
FCSVPMEEVPRKRHLGDSSFWTDTLSMNLRETFDEAFLAAVRAHQGLPALPSPKPPLP
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgccgagtctccaggacgcgtgggccgtggggtggggtaaccaactggtcggtgacccg
gccagggaggcgcgccgttcccgcccctccaccacgcccctagtccgggagtgcctgccg
gcctccgcccgtagcgccagctggcacttcgtcaggtgggcggcggcggcggcacccatc
aggcggcggtacctctccggggacgtacacctgcaactggcaaagaagggctcaaccacc
cgcaaagagtcggcggtccggcggcgcagttccatgagtctagccgaggagtgggaccag
agggcgatgggaggaagctactaccaactgttcgcggcctcactgggcaacctggaatgg
ttgcggttctgtttaaaccggcatcgtggcgaaatcctggccgatgacaagggtttcact
gccatccactttgcagcccagagtggcaagcttgcatgcctgcaggtcttggtggaggag
tacaagtttcccgtaaacctgcccaccaacaatggccagacacctctgcaccttgtcatc
catggtgacaacaagaccgtggccctcgcctgcattcactatctgattaagcaaggggcg
gccctcaacactcagacgtgcaatggctccacacctctgcatctggcagcccgcgaaggc
ctgctgagctgtgtcaaagtcctggtgcagaaaggtgccaacgtccacgcacaagatgcc
acaggctgcaagcccattgactactgcaaaatatggaaccaccgagtctgtgcccggttc
ttgaaagatgccatgtggaaacgggacaaggaggactttgcccatgagatgaggaaactg
aagaggctcaaggaccagctggccctcatggaggaggactacctgactgagtatcaaaag
gagcaccaaattctgagagaagctgactttaagaagtggctccatcacaagttgctactc
caagaccagtccctaatacccagtgttcagcgagagccccgtgctccaccccgggccact
gccctctccaagacctgcaaggacggggtactgtggcctcccacgagcttccacccctcc
ccggaggcacgcctgcaacagatacagcagcccaatctgcccttggtgatgtctgtgccc
acctacaagccgcccacgatcaggcggcccaaggtgtggaatcttagcagcaatcccacc
aggtcccccaccgcccagatcggctacccacagggcgtccgcctgggcgtgcatcccgac
cccaggccagagcgtgacttccgctgcttcgtggaggtgaggtccgacgggcacggtggc
gcgcacctgcgcacggtggccggccgccaggtggcgcctgtgccccggctgcctttcgaa
gtggtaatccgcgagctgcacccttcggtgcggccctacagaatgaaggtgccccaggac
ttctgctctgtccctatggaagaggtgccccggaagcggcacttgggtgacagcagcttc
tggaccgacacgctgagcatgaacctgcgagagacattcgacgaggccttcctggcggct
gtgcgagcccatcaaggactccccgctctgccttcccctaaaccacccctcccttaa

DBGET integrated database retrieval system