KEGG   Bos mutus (wild yak): 102277154Help
Entry
102277154         CDS       T02919                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
bom  Bos mutus (wild yak)
Pathway
bom04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:bom00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102277154 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102277154 (CREM)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102277154 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 102277154
NCBI-ProteinID: XP_005906517
Position
Un
AA seq 360 aa AA seqDB search
MSKCGRKKYMKTNLRQMTMETIDSQQDGSLPDSVAESESAHMQTQTGQNSIPTLAQVSVA
GSSTGRGSPAVTLVQLPSGQTVHVQGVIQTPQPSVIQSPQIRTVQVATIAETDESAESEG
VIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEEKSEEEGTPPNIAAMAVPTSIYQT
STGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAAQSADGTQQFFV
PGSQVVVQDEETELAPSHMAAATGDMPTYQIRAPTTALPQGVVMAASPGSLHSPQQLAEE
ATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtggcaggaaaaaatatatgaagacaaatctaagacaaatgaccatggaa
acaattgactctcagcaggatggaagtttaccagattctgtggcagagagcgaatctgct
cacatgcagacgcagactggtcaaaattcaatccccactttagctcaggtttctgtagct
ggatccagcaccggaagaggctccccagctgtaactctagtacagttaccttccggccag
accgtccatgtccagggagtaattcagacaccacagccatccgttattcagtcaccacaa
atacgaactgttcaggtagcaaccattgcagaaacagatgagtctgcagaatcagaaggt
gtaattgattctcataaacgtagagaaatcctttcacgaagaccctcttacagaaaaata
ctgaatgaactttcctctgatgtgcctggtgtacccaagattgaagaagaaaaatcagag
gaagagggaacaccgcctaacatcgctgctatggcagtgccgactagcatatatcagact
agcacggggcaatacattgctatagcccaaggtggaacaatccagatttctaacccagga
tctgatggtgttcagggactgcaggcattaacaatgacaaattcaggagctcctccacca
ggtgctacaattgtgcagtacgcagcacagtcagcagatggcacacagcagttctttgtc
ccaggcagccaggtggtggttcaagatgaggaaactgaacttgccccaagtcacatggct
gctgccactggcgacatgccgacttaccagatccgagctccgactactgctttgccacag
ggagtggtgatggctgcctcccccggaagcctgcacagtccccagcagctagcagaggaa
gcgacacgcaaacgggagctgaggctaatgaaaaacagggaagctgctaaagaatgtcga
cgtcgaaagaaagaatatgtcaagtgtctggagagtcgagtcgcggtgctggaagttcaa
aacaagaagcttatagaggaactggaaaccttgaaagacatttgctctcccaaaacagat
tag

DBGET integrated database retrieval system