KEGG   Bos mutus (wild yak): 102277956
Entry
102277956         CDS       T02919                                 

Gene name
AHRR
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bom03000]
    102277956 (AHRR)
Transcription factors [BR:bom03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102277956 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 102277956
NCBI-ProteinID: XP_005894720
Position
Un
AA seq 696 aa
MIPPGECLYAGRKRRKPVQKQRPAVGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIISK
LDKLSVLRLSVSYLRVKSFFQALQERCPRQPVAAAPSPGDRGPRGGSAGSTVLEGRLLLE
SLHGFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDP
PQAGCGQPLLSETGEDAVLGRLLRAQEGGADPPTEYSAFLTRCFICRVRCLLDSTSGFLT
MQFQGRLKFLFGQNRRAPSGAALLPRLALFCVAAPLALPPGVEVRVKTVYLRAKHRADVP
ASTDAKAKAASSLCESELLGNTNYSAGRSNGENGLSLFRTPEDACRWGRVTARGPCLCLR
GGPDLVLDPDGTSGAEEGEELGGLPRDVPPYSCRLESLGPVKHLDWAAGRHGQDDGSAKL
KLEPGKADPFPTAPAHGACLPYLGAQGTVHSLRSSPSSHPPRPPPGACASRTSRALRDGH
QGPAPPPTPGPFPQGGLDSRVPRPAVQHLPVGGYPAEDKLRGLLMPPGAPSHPALSLDVP
IKMESDSGSEDAVDGYCMSPAQVWLGAGNPAKRQLVTFPTRMHLKTEPGARLPLYTPPPG
PGLLGAPPRPGRGLAPLHPTSCACLEPPPRLCIRGHQPFNLGCNCRAPGPAPAVKLEPLD
SPLWAAHGQGGPPGLFSKSAPAAGMPPRDTQCAFLP
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgatcccaccgggggagtgcctgtacgccgggagaaaacgcaggaagcccgttcagaaa
cagaggcctgccgtgggcgctgagaagtcgaacccttccaagcggcaccgggaccgcctc
aatgccgagctggaccacctggccagcctgctgccgctgccgcccgacatcatctctaag
ctcgacaagctttctgtcctgcgtctcagcgtcagctatctcagggtgaaaagcttcttc
caagccctgcaggagaggtgcccgaggcagccggtggctgctgccccctcgccgggagac
cggggtccacgcggagggtctgcaggctcgaccgtgctggagggaaggctgctgctggag
tccctccacggcttcgctctggtggtgagcgcggaagggatgatcttctacgcatcggcc
acgatcgtggactacctgggcttccaccagacagatgtgatgcaccagaatatttatgac
tacatccacgtggatgaccgccaggacttctgccggcagctgcactgggccatggaccct
ccccaggcagggtgcgggcagccactactctcagagacaggagaggatgccgtcctgggg
aggctgctccgggcccaggaggggggcgcagacccgcccaccgagtactcggccttcctg
acacgctgcttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacg
atgcagtttcaaggacgactgaagttcctcttcggtcagaacaggcgggcgccctcgggc
gcagccctgctcccgcggctggccctgttctgtgtggcggcccccctggccctgccgccg
ggcgtggaggtgagggtgaagaccgtgtacctgagggcgaagcacagggcggacgtcccg
gcctccaccgacgcaaaagcaaaagctgcctcaagtctctgcgaatcagaattgcttgga
aacaccaattactcagcagggagaagcaatggagaaaacggcctttccttgttcaggaca
ccagaggacgcctgccgctggggccgggtcacagcccggggcccctgcctgtgcctccgg
ggcggccctgaccttgtccttgaccccgatggcacctcaggggcagaggaaggagaggag
ctcggggggctcccgcgggacgtgcccccttacagctgccgcctggagtccctgggccct
gtgaagcacctggactgggcggccgggaggcacggtcaggatgatggcagtgccaagctg
aagctggagcccggcaaggctgacccgttccccaccgccccggcccacggcgcctgcctg
ccctacctgggtgcgcaaggcaccgtccactccctccggagctcacccagctctcaccca
cccaggccgccccctggggcctgcgccagccggaccagcagagccctgcgggacgggcac
cagggcccagcgccgccccccacacccggccccttcccccaggggggcctggacagcagg
gtccctcggccagcagtccagcatctcccggtgggcggctaccccgctgaggacaagctg
cgaggccttctgatgcccccgggagccccgagtcaccccgcgttgtcactcgatgtgccc
atcaagatggagagtgactcagggtccgaggacgcggtggacggctactgcatgtcccca
gcccaggtgtggctgggggccggcaatccggccaagagacagctggtcaccttccccacc
aggatgcaccttaagacggagccgggcgccaggctccccctgtacaccccacccccaggg
cctggcctgctgggcgccccccccagacccggcagggggctggccccgctgcaccccacg
tcctgtgcctgcctggagcccccaccccgcctctgcattcggggccaccagcccttcaac
ctgggctgcaactgccgggctcccgggccagctcccgcagtcaagctcgagcccctagac
tcgcccctgtgggcagctcacggccagggcgggccgcctgggctgttctccaagagcgcc
ccggccgcggggatgccccccagggacacgcagtgcgccttcctgccctag

DBGET integrated database retrieval system