KEGG   Bos mutus (wild yak): 102278451Help
Entry
102278451         CDS       T02919                                 

Gene name
DOCK8
Definition
(RefSeq) dedicator of cytokinesis 8
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bom04131]
    102278451 (DOCK8)
Membrane trafficking [BR:bom04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    102278451 (DOCK8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 GPR15L
Motif
Other DBs
NCBI-GeneID: 102278451
NCBI-ProteinID: XP_005900074
Position
Un
AA seq 2101 aa AA seqDB search
MATLPSAERRAFALKINRYSSAEIRKQFTLPPNLGQYHRQSISTSGFPSLQLPQFYDPVE
PVDFEGLLMTHLNSLDVELAQELGDFSEDDLDVAFTPKECRTLQPSLPEEGVELDPHVRD
CVQTYIREWLIVNRKNQGSSEVCSFKKTGSRKDFHKTLQKQTFESETLECSEPSAQAGPR
HLSVLCDVSGKGPNTACDFDLRSLQPDPRLENLVQQVSAEDFEKQNEEARRTNRQAELFA
LYPSVDEEDAVEIRPVPECPKEHLGNRILVKLLTLKFEIEIEPLFASIALYDVKERKKIS
ENFHCDLNSDQFKGFLRAHTPSVASSSQARSAVFSVTYPSSDIYLVAKIEKVLQQGEIGD
CAEPYMVIKESDGGKSKDKIEKLKLQAESFCQRLGKYRMPFAWAPISLASFFSVSTLDRE
VTDVESMVGKGSAGERRTLSQSRRLSERAFSLEENGVGSNFKTLTINSFFKQEGDRLSDE
DLFKFLADYKRSSSLQRRVKSIPGLLKLEISLAPETINCCLTPEMLPVRPFPENRGRPHK
EILEFPIREVYVPHTVYRNLLYVYPQRLNFANKLASARNITIKIQFMCGEDASSAMPVIF
GKSNGPEFLQEVYTAVTYHNKSPDFYEEVKIKLPAKLTVNHHLLFTFYHISCQQKQGNSV
ESLLGYSWLPILLNERLQTGSYCLPVALEKLPPNYSMHSAEKVPSQNPPIKWAEGHKGVF
NIEVQAVSSVHTQDNHLEKFFTLCHSLESQVTFPIRVLDQKISESALEHELKLSIICLNS
SRLEPLVLFLHLVLDKLFQLFVQPMVIAGQPANFSQFAFESVVVTANSLHNSKGLGKDQH
GRNCLLASYVHYVFRLPEPQRDVPKPGGPTVLPDPRYHTYGRTSAAAVSSKLLQARVMSS
SNPDLAGPHCAADEEVKSIMSSKIADRSCNRMSYYCSSNSDAPSSTTAPRPVSKKHFHEE
LALQMVVSTGMVKETVFKYSWFFFELLVKSMAQYVHNMDKRDNFRRTRFSDRFKDDITTI
VNVVTSEIAALLVKPQKETEQAEKINISLAFFLYDLLSLMDRGFVFNLIKHYCNQLSAKL
NNLPTLISMRLEFLRILCSHEHYLNLNLFFMNADTAPASPCPSISSQNSSSCSSFQDQKI
ASMFDLTPEYRQQHFLTGLLFTELAAALDAEGEGIIKVQRKAVSAIHSLLSSHDLDPRCV
KPEVKVKVAALYLPLVGIILDALPQLYDFTAAEARGGKNRANGSDEEQEGTSAINQNVAL
AIAGNFNLKTSGTMLSSLPYKQYNMLNADTTRNLMICFLWIMKNADQTLLRKWIADLPSM
QLNRILDLLFICVSCFEYKGKQSSDKVSTQVLQKSRDVKARLEEALLRGEGARGEMMRRC
RTPGNDRFPGLNENLRWRKEQTHWRQANEKLDKTKAELDQEALISGNLATEANLIILDMQ
ENIIQASSALDCKDSLLGGVLRVLVNSLSCDQSTTYLTHCFATLRALIAKFGDLLFEEEV
EQCADLCQRVLHHCSSSMDITRSQACATLYLLMRFSFGATSNFARVKMQVTMSLASLVGK
AQDFNEEYLRRSLRTILAYAEEDTAMQTTPFPMQVEELLCNLNSILYDTVKMREFQEDPE
MLMDLMYRIAKSYQASPDLRLTWLQNMAEKHTKRKCYTEAAMCLVHAAALVAEYLSMLED
HSYLPVGSVSFQNISSNVLEESAVSDDTLSPDEDGVCSGRYFTESGLVGLLEQAAELFST
GGLYETVNEVYKLVIPILEAHRDFRKLTSTHEKLQKAFDSIISKGHKRMFGTYFRVGFYG
SKFGDLDEKEFVYKEPAITKLPEISHRLEAFYSQCFGAEFVEVIKDSAPVDKTKLDPNKA
YIQITFVEPYFDEYEMKDRLTYFEKNFNLRRFMYTTPFTLEGRPRGELHEQYRRNTILTT
LHAFPYIKTRISVAQKEEFVLTPIEVAIEDMKKKTLQLAVAINQEPPDAKMLQMVLQGSV
GATVNQGPLEVAQVFLAEIPADPKLYRHHNKLRLCFKEFIMRCGEAVEKNKRLITADQRE
YQXXXXELKKNYNKLRENLRPMIERKIPELYKPIFRVDSQKRDSFHRSSFRKCETQLSQG
S
NT seq 6306 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctgccgagcgcagagcgccgtgccttcgcgctcaagatcaacaggtattct
tctgcggaaataaggaaacagtttaccctcccaccaaaccttggccagtaccatcgacaa
agcataagtacctctggcttcccctctcttcaactacctcagttctatgacccagtggag
ccagtggacttcgaagggcttctgatgacacacctgaacagcctggatgtggagcttgcc
caggagctgggagacttctccgaggacgacttggatgtggcgttcacgccgaaggaatgt
cgaactttgcagccctctttgccggaggaaggggttgaactcgacccacacgtcagggac
tgtgttcagacctatattcgggagtggctaattgtgaatcggaaaaaccaaggaagctca
gaggtttgcagctttaaaaagactggatcccgaaaagattttcacaagacgcttcagaaa
cagacgtttgagtcagaaaccttggagtgcagtgaacccagcgctcaggcaggtccccgc
cacctgagcgtgctgtgtgatgtctctgggaaaggtcccaacactgcctgtgacttcgac
ctccgcagcctgcagcctgacccgaggctggaaaacctcgtacaacaagtgagcgctgag
gacttcgagaagcagaatgaggaggcccggaggaccaatcggcaggccgagctctttgcc
ctttatccatcagtggatgaggaggatgctgtggaaatacgtccggtaccagaatgtccc
aaggaacatctgggaaacagaatattggtcaagttgctgaccctgaagtttgagatagaa
attgagcccctgtttgccagcattgccctctatgatgttaaagaaaggaaaaagatatca
gaaaattttcactgtgacctgaactctgaccagtttaaaggatttctgcgtgctcacacg
ccctctgttgcctcatccagtcaagcaagatctgcggtgttctcagtcacctacccatcc
tcggacatctacctcgtagccaagattgaaaaagtccttcagcagggagagattggagac
tgtgcagaaccctacatggttatcaaagaaagtgatggtggaaagagtaaagacaagatt
gaaaaactaaaacttcaagctgaatccttctgccaacgtttggggaaataccggatgccc
tttgcttgggctcccataagcttagcaagtttcttcagtgtctctaccctggacagggag
gtaaccgatgtggagtccatggttgggaaaggctctgcgggtgagcggagaactttgtcc
caatctcgaagactttctgaaagagccttctccttggaggaaaatggggttggatccaac
ttcaagactttaaccattaacagctttttcaagcaggaaggagatcgcctcagtgatgaa
gacttattcaagtttttagctgactacaaaagatcttcatccctacagagaagagtcaag
tcaattccaggcttgctcaaactggagatatctctggctccagagaccatcaattgctgt
ctgactcctgaaatgctgccagtgaggccctttcctgaaaaccggggacgcccacacaaa
gagatactggaatttccaatccgagaagtatatgtccctcatactgtgtacagaaacctt
ctgtatgtctacccacagaggctgaactttgctaacaaactagcatctgcccggaacatc
acaatcaaaatccagtttatgtgtggagaggatgccagcagtgctatgccagtcatcttt
ggaaaatccaatggccctgaatttcttcaggaagtatacacagctgttacataccataac
aagtctcctgacttctatgaagaagtgaaaattaagctccctgctaagcttacagtaaat
caccacctcctgttcaccttctatcatatcagctgtcagcagaagcaaggaaactcagta
gaaagtctcctgggatattcatggctgccaattctcttaaatgaacgtcttcaaactgga
tcctactgtctcccagttgccttggaaaagctgccacccaactactctatgcattctgca
gagaaagtcccttcacagaatcctcccattaaatgggctgaaggacataagggagtattc
aatattgaagtgcaagctgtttcttctgttcacacccaggacaaccatctagagaagttc
ttcaccctctgccactctctggagagccaggtgaccttccccatccgtgtgctggaccag
aagatcagtgaatcggcactggaacatgagctgaagctcagcatcatctgcctaaactcc
tcccgcctagagccccttgtgctcttcctgcatctggtgctggacaagctcttccagctg
tttgtgcagcccatggtcatcgctggtcagccagccaacttctctcagtttgccttcgag
tccgtggtggtcaccgccaacagtctgcacaacagcaagggcctgggcaaggaccagcac
gggaggaactgcctgctggcctcttacgtgcactacgtcttccgcctgccggagccacag
agagacgtgcccaagccaggtggccccactgtcctcccagaccctcgctaccacacgtat
ggacgcacatctgctgcagctgtgagttcgaagctgctgcaggcccgggtgatgagcagc
agtaacccagaccttgcggggccacactgtgcagcagatgaggaagttaagagcatcatg
tcttcaaagattgctgatcgcagctgcaaccggatgtcttactattgctccagcaatagt
gatgctccaagttcaacaacagcccccaggccagtcagcaaaaagcatttccatgaggag
cttgccctacagatggtggtcagcactggaatggtgaaagaaacagtcttcaagtactcc
tggttcttctttgagcttctggtgaaaagcatggcccagtatgtacataacatggacaag
cgggacaattttcggaggactcgtttttctgaccgtttcaaagatgacataactactatt
gttaatgtggtcacctcggagattgcagcccttttagtaaaacctcagaaggaaactgaa
caggccgaaaagatcaacattagcctggctttcttcttgtatgacctcctctcactcatg
gatcgtggctttgtgtttaacctcatcaaacattattgcaaccagctgtcagccaagctc
aacaaccttccaacgctcatttccatgaggctggagttcctgagaattctctgcagccat
gagcattacctcaatctgaacctcttctttatgaatgcggatactgctccagcatctccc
tgtccctccatatcttcccagaactccagctcctgctccagtttccaggaccagaagatt
gctagcatgttcgacctgacaccggagtaccgccagcagcacttcctcaccgggcttctc
ttcaccgagctggccgctgccctggatgctgaaggggaagggatcatcaaagtacaaagg
aaagctgtcagtgccatccacagcctgctgagttctcacgacctggacccgcgttgtgtt
aaaccagaggtgaaggtcaaagttgctgccctctacctgcctttggttggtatcattttg
gatgctttgccacagctctatgactttacagctgcagaagctcgaggtggaaaaaatcgt
gccaatggctcagatgaagaacaagaagggaccagtgcaattaatcagaatgtggcattg
gctatagctggaaattttaatttgaagacaagtggaacaatgttgtcttccctgccctac
aagcagtacaacatgctgaatgctgacacgacccgaaacctcatgatctgcttcctgtgg
atcatgaaaaatgctgaccagaccctccttaggaagtggatcgccgacctgccatccatg
cagctaaacaggattttagatctccttttcatctgtgtctcatgttttgaatacaaggga
aaacagagttctgacaaagtcagtacccaagttctgcagaagtcgagggatgtcaaggcc
aggctggaagaggctttgctccgtggggaaggggcccgaggggagatgatgcggcgctgc
cggactccagggaatgaccgatttccaggcctaaatgaaaatttgagatggaggaaagag
cagacacactggcggcaagctaatgagaagctagataaaacaaaggcagagttagatcaa
gaagccttgatcagtggcaatctggctacagaagcaaatttaatcatccttgatatgcag
gaaaacattatccaggcgagctcggctctggactgtaaagacagccttctgggaggcgtg
ctaagagtccttgtgaattctctgagctgtgatcagagcaccacatacctaactcactgc
tttgcgacactccgtgctctcattgccaagtttggcgacttgttgtttgaggaggaagtg
gagcagtgtgcagacctgtgtcagcgagtgctgcaccactgcagcagcagcatggacatc
acccgcagccaagcctgcgccactctctacctcctcatgaggttcagctttggagccacc
agcaactttgcaagagtaaagatgcaagtaaccatgtctctggcatctttggtgggaaaa
gcacaagactttaatgaggaatacctgagaagatccttgaggacaattttggcctacgca
gaagaggacacagccatgcagaccactccttttcccatgcaggtggaagaacttctctgc
aatctgaatagcatcttatatgacacagtgaaaatgagggaatttcaggaagatcctgag
atgcttatggatctcatgtacagaattgccaagagttaccaggcctctcctgatctgcgg
ctgacctggctccagaacatggcagagaaacacaccaagaggaagtgctacacggaggcc
gccatgtgcctggtccatgcagctgctttggtggccgaatatctgagcatgctggaggac
cacagctatctgcccgtgggcagcgtcagctttcagaatatttcttccaacgtactggag
gagtctgccgtctctgatgacaccctgtcgcctgatgaggatggggtgtgctccggccgg
tacttcacggagagtggcctggtgggcctactggagcaggcggccgagctcttcagcacg
ggaggactgtacgagacggttaatgaagtctacaagctggtcatccccatcctggaagct
catcgagacttccggaagctgacctccacccatgaaaagctgcagaaggcctttgacagc
atcattagcaagggtcataagaggatgtttggaacctacttccgagttggtttctatgga
tccaaatttggggatttggatgagaaggaattcgtttacaaagagcctgcaattaccaag
cttcctgagatctctcacagactagaggcattttatagtcaatgttttggtgcagaattt
gtagaagtgataaaagactctgctcctgtggacaaaaccaagttggaccctaacaaggcc
tacatacagatcactttcgtggagccctactttgatgagtatgagatgaaagacaggcta
acctactttgagaagaacttcaacctgcggaggttcatgtacaccacccccttcaccctg
gagggccggcctcggggcgagctccatgagcagtaccggcggaacaccatcctgaccacc
ctgcacgccttcccctacatcaagaccaggatcagtgttgcccagaaggaggagtttgtt
ttgacaccaattgaagttgccattgaagatatgaaaaagaagactctgcaattagcagtt
gccattaaccaggagcctcctgatgccaagatgcttcagatggtgctgcaaggctctgtt
ggagctactgtcaatcagggaccactggaagtagcccaagtatttttggctgaaattcca
gctgacccaaaactttatcggcatcacaacaagttgagattatgctttaaggaattcata
atgcgatgcggggaagccgtagagaaaaacaaacgtctcatcacggcagatcagagggag
tatcagnnnnnnnnnnnngaactcaagaagaactataacaagctgagagagaacctccga
ccaatgatcgagcggaaaattccggaactctacaagccaatattcagagttgacagtcaa
aagagagactccttccacagatctagtttcaggaaatgtgaaacccagttgtcacagggc
agctaa

DBGET integrated database retrieval system