KEGG   Bos mutus (wild yak): 102278686Help
Entry
102278686         CDS       T02919                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00120  Primary bile acid biosynthesis
bom01100  Metabolic pathways
bom03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102278686
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102278686
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bom00199]
    102278686
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     102278686
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     102278686
Cytochrome P450 [BR:bom00199]
 Cytochrome P450, animal type
  CYP8 family
   102278686
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 102278686
NCBI-ProteinID: XP_005891143
Position
Un
AA seq 169 aa AA seqDB search
MVLWGPALGALLVAIVGYLCLRGLLRQRRPKEPPLDKGPVPWLGHAMAFRKNMFEFLRHM
QAKHGDIFTVQLGGQYFTFVMDPLSFGPILKDAQRKLDFVEYAQKLVLKVFGYRSVQGDY
RMIHSASTKHLMGEGLEELNKLNPSISFHVGPVDSVYPTARDFFFQKHL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggtgctctggggtccggcgctgggagccctgctagtggccattgtgggatatctgtgc
cttcgggggctgctccggcaacgaagacccaaggagcccccactggataagggccccgtg
ccctggctgggccatgccatggctttccggaagaatatgttcgaatttctgaggcacatg
caggccaaacatggggacatattcacggtacagctagggggccagtacttcacctttgtc
atggaccctctgtcttttggccctatcctcaaggatgcgcagaggaagctagactttgtg
gagtatgctcaaaaactggtgctaaaggtatttggataccgctctgtgcagggagactat
aggatgatacactcagccagcaccaagcacctcatgggggaaggcttggaggagctcaac
aaactcaatcccagcatctctttccacgtggggcctgtggactctgtttaccctactgcc
agagacttttttttccaaaagcacctctga

DBGET integrated database retrieval system