KEGG   Bos mutus (wild yak): 102280846Help
Entry
102280846         CDS       T02919                                 

Gene name
SCD
Definition
(RefSeq) stearoyl-CoA desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bom  Bos mutus (wild yak)
Pathway
bom01040  Biosynthesis of unsaturated fatty acids
bom01212  Fatty acid metabolism
bom03320  PPAR signaling pathway
bom04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    102280846 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102280846 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102280846 (SCD)
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     102280846 (SCD)
Lipid biosynthesis proteins [BR:bom01004]
 Desaturase
  First
   102280846 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 102280846
NCBI-ProteinID: XP_005892117
UniProt: L8IUY7
Position
Un
AA seq 359 aa AA seqDB search
MPAHLLQEEISSSYTTTTTITAPPSRVLQNGGGKLEKTPLYLEEDIRPEMRDDIYDPTYQ
DKEGPKPKLEYVWRNIILMSLLHLGALYGITLIPTCKIYTYLWVLFYYLMGALGITAGAH
RLWSHRTYKARLPLRVFLIIGNTMAFQNDVFEWSRDHRAHHKFSETDADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLNLSDLRAEKLVMFQRRYYKPGVLLLCFILPTLVPWYLWDE
TFQNSLFFATLFRYALGLNVTWLVNSAAHMYGYRPYDKTINPRENILVSLGAVGEGFHNY
HHTFPYDYSASEYRWHINFTTFFIDCMAAIGLAYDRKKVSKAAILARIKRTGEESYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaagaggagatctctagctcctacacaaccaccaccaccatc
acagcacctccttccagggtcctgcagaatggagggggcaaattggagaagactccccta
tacttggaagaagacatccgccctgaaatgagagatgacatctatgacccaacttaccag
gataaggagggcccaaagcccaagcttgagtatgtttggagaaacatcatcctcatgtct
ctgttacacttgggagccctatatgggatcacattgatccccacctgcaagatatacacc
tatctctgggtgttattctactatctgatgggtgccctgggcatcacagcaggggcccat
cgcctgtggagtcaccgaacctacaaagctcggctgcctctgagggtcttcctgatcatt
ggcaacaccatggcgttccagaatgacgtttttgaatggtcccgagatcaccgtgcccac
cacaagttttcagaaacggatgccgacccccacaattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagaaaagggttccacgcta
aatttatccgacctaagagccgagaagctggtgatgttccagaggaggtactacaaacct
ggtgtcctgttgttgtgcttcatcctgcccacactcgtgccgtggtatctgtgggatgaa
acgtttcaaaacagcttgttttttgccaccttattccgttatgcccttgggctcaacgtc
acctggctggtgaatagtgctgcccatatgtatggataccgcccttatgacaagaccatc
aacccccgagagaatattctggtttcactgggagctgtgggtgagggcttccacaactac
caccacacctttccttatgactactcagccagtgagtaccgctggcacatcaactttacc
acgttcttcattgattgcatggctgccatcggtctggcttatgaccggaagaaagtatcc
aaggctgccatcttggccaggataaaaagaactggagaggaaagctacaagagtggctga

DBGET integrated database retrieval system