KEGG   Bos mutus (wild yak): 102281009Help
Entry
102281009         CDS       T02919                                 

Gene name
ACSBG1
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 1
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00061  Fatty acid biosynthesis
bom00071  Fatty acid degradation
bom01100  Metabolic pathways
bom01212  Fatty acid metabolism
bom03320  PPAR signaling pathway
bom04920  Adipocytokine signaling pathway
Module
bom_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    102281009 (ACSBG1)
   00071 Fatty acid degradation
    102281009 (ACSBG1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102281009 (ACSBG1)
   03320 PPAR signaling pathway
    102281009 (ACSBG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bom01004]
    102281009 (ACSBG1)
Enzymes [BR:bom01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     102281009 (ACSBG1)
Lipid biosynthesis proteins [BR:bom01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   102281009 (ACSBG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-GeneID: 102281009
NCBI-ProteinID: XP_005906664
Position
Un
AA seq 707 aa AA seqDB search
MPDSRAAPQESLLDASLGTTQENVGTSSLTDGQMLSKEPLSHALKLSTPEKVKDAQLNPP
EEALWTTRADGRVRLRIDPICSQTPRTVHQMFSTTLDKYGDLSAMGFKRQGSWEHISYTQ
YYLLARKAAKGFLKLGLERAHSVAILAFNSPEWFFSAVGAVFGGGIITGIYTTSSPEACQ
YIAYDCRANIIVVDTQKQLEKILKIRKHLPHLKAVVIYREAPPMRMPSVYTMEELMELGN
EVPEEALDVIIKAQKPNQCCALVYTSGTTGNPKGVMLSQDNITWTARYGSQAGDIQPAEI
QQEVVVSYLPLSHIAAQIYDLWTGIQWGAQVCFAEPDALKGSLVNTLREVEPTSHMGVPR
VWEKIMERIQEVAAQSGFIRRKMLLWAMSVTLEQNLTCPSSDLKPFTTRLADYLVLAKVR
QALGFAKCQKNFYGAAPMTVETQHFFLGLNIRLYAGYGLSETSGPHFMSSPYNYRLYSSG
KVVPGCQVKLVNEDAEGIGEICLWGRTIFMGYLNMEDKTCEAIDAEGWLHTGDTGRLDAD
GFLYITGRLKELIITAGGENVPPVPIEEAVKTELPIISNAMLIGDQRKFLSMLLTLKCTL
DPDTFEPTDNLMEQAVEFCQRVGSKATTVSEVVGKKDEAVYQAIEEGIQRVNMNAAARPY
HIQKWAILEKDFSISGGELGPTMKLKRLAVLEKYKDVIDSFYQEQKK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgccggacagcagagcagccccgcaggagagcctgctggatgcaagcctggggaccacc
caagaaaacgtgggaaccagctccctgactgatgggcagatgctctccaaagagccccta
agccatgctctcaaactctcgaccccagagaaggtgaaagatgcccaattgaatcctcca
gaggaggcgctatggacgactcgggccgacgggcgcgtccgcctacgcatagaccccatc
tgctcgcagactccccgcactgttcatcagatgttctccacgactctggacaagtatggg
gacctcagtgctatgggcttcaagaggcagggctcgtgggaacacatctcctacacccag
tactacctgctggcccgcaaagctgccaagggcttcctgaagctcggcctggagcgggcc
cacagcgtggccatcctcgccttcaactccccggagtggttcttctcagcagtgggcgca
gtcttcggaggtggcatcatcaccggcatctacacgaccagctcccctgaggcctgtcag
tatatcgcctatgactgccgcgccaacatcatcgtggtcgacacacagaaacagctggaa
aagatcctgaagatcaggaaacacctaccacatctgaaggcagtagtgatatatagagaa
gcgcctcccatgcggatgcccagcgtgtacacgatggaggagctcatggagctggggaat
gaggtgcctgaggaggccctggacgtcatcatcaaggcccagaagcctaaccagtgctgt
gcattggtctacacgtcgggcaccaccgggaaccccaagggtgtgatgctgagtcaggac
aatatcacgtggacagcacggtacggcagtcaggccggtgacatccaacctgcggaaatc
caacaggaggtggtggtcagctacctgcctctcagccacattgccgcccagatctatgac
ctgtggacaggcatccagtggggggcccaggtctgctttgccgagcctgatgctctgaag
gggagtctggtgaacacgctgcgggaggtggagcccacgtcccacatgggggtgcctcgg
gtgtgggagaagatcatggagcggatccaggaggtggcggctcagtctggcttcatccgg
cgcaagatgctgctctgggccatgtcggtgaccttggagcagaacctcacctgcccgagc
agcgatctgaagcccttcacaacccgactggcagattacctggtgctagccaaggtccgc
caggcgctaggctttgccaagtgtcagaagaacttctacggggcagcccccatgactgtg
gagacacagcacttcttcctgggcctcaacatccgcttgtatgcaggctacggcctcagc
gagacctcaggcccccacttcatgtccagcccctacaactaccgactctatagttccggc
aaggtggtgccaggctgccaggtgaagctggtgaatgaggacgcagagggcattggggag
atctgcctgtggggccgcaccatcttcatgggctacctgaacatggaggacaagacgtgt
gaggctatcgatgctgagggctggctgcacaccggagacacgggccgcctggatgccgac
ggcttcctctatatcacggggcgtctcaaagagttaatcatcacggctggtggggagaac
gtgccccctgtgcccattgaggaggccgtgaagacggagctgccaatcatcagcaatgcc
atgctgattggagaccagaggaagttcctgtccatgctgctaaccttgaagtgcactctg
gaccctgacacctttgagcccacggataatctgatggaacaagctgtagagttctgccag
agggttggcagcaaagccaccacggtatctgaggttgtggggaagaaggatgaggccgtg
tatcaggccatcgaagaagggatccagagagtcaacatgaatgcagctgcacgaccctac
cacatccagaagtgggccattcttgagaaggacttctccatttcaggtggagagttgggt
cccacaatgaaactgaaacggctcgcagtcctggagaagtacaaagatgtcatcgattct
ttttaccaagagcaaaaaaagtaa

DBGET integrated database retrieval system