KEGG   Bos mutus (wild yak): 102281889Help
Entry
102281889         CDS       T02919                                 

Gene name
FASLG
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
bom  Bos mutus (wild yak)
Pathway
bom01524  Platinum drug resistance
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04060  Cytokine-cytokine receptor interaction
bom04068  FoxO signaling pathway
bom04151  PI3K-Akt signaling pathway
bom04210  Apoptosis
bom04217  Necroptosis
bom04650  Natural killer cell mediated cytotoxicity
bom04722  Neurotrophin signaling pathway
bom04932  Non-alcoholic fatty liver disease (NAFLD)
bom04940  Type I diabetes mellitus
bom05142  Chagas disease (American trypanosomiasis)
bom05143  African trypanosomiasis
bom05160  Hepatitis C
bom05161  Hepatitis B
bom05162  Measles
bom05163  Human cytomegalovirus infection
bom05164  Influenza A
bom05165  Human papillomavirus infection
bom05168  Herpes simplex virus 1 infection
bom05170  Human immunodeficiency virus 1 infection
bom05200  Pathways in cancer
bom05205  Proteoglycans in cancer
bom05320  Autoimmune thyroid disease
bom05330  Allograft rejection
bom05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102281889 (FASLG)
   04010 MAPK signaling pathway
    102281889 (FASLG)
   04068 FoxO signaling pathway
    102281889 (FASLG)
   04151 PI3K-Akt signaling pathway
    102281889 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102281889 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102281889 (FASLG)
   04217 Necroptosis
    102281889 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102281889 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102281889 (FASLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102281889 (FASLG)
   05205 Proteoglycans in cancer
    102281889 (FASLG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    102281889 (FASLG)
   05330 Allograft rejection
    102281889 (FASLG)
   05332 Graft-versus-host disease
    102281889 (FASLG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102281889 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102281889 (FASLG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102281889 (FASLG)
   05162 Measles
    102281889 (FASLG)
   05164 Influenza A
    102281889 (FASLG)
   05161 Hepatitis B
    102281889 (FASLG)
   05160 Hepatitis C
    102281889 (FASLG)
   05168 Herpes simplex virus 1 infection
    102281889 (FASLG)
   05163 Human cytomegalovirus infection
    102281889 (FASLG)
   05165 Human papillomavirus infection
    102281889 (FASLG)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    102281889 (FASLG)
   05143 African trypanosomiasis
    102281889 (FASLG)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102281889 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102281889 (FASLG)
   04052 Cytokines and growth factors [BR:bom04052]
    102281889 (FASLG)
   04090 CD molecules [BR:bom04090]
    102281889 (FASLG)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102281889 (FASLG)
Cytokines and growth factors [BR:bom04052]
 Cytokines
  Tumor necrosis fators
   102281889 (FASLG)
CD molecules [BR:bom04090]
 Proteins
  102281889 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 102281889
NCBI-ProteinID: XP_005892343
UniProt: L8IS06
Position
Un
AA seq 277 aa AA seqDB search
MQQPLNYPYPPIFWVDSSASSPWAPPGSVFPCPSSVPGRPGQRRPPPPPPPTLPPPPPLP
PLPPPPLKKRRDHNTGLCLLVMFFMVLVALVGLGLGIFQLFHLQKELAELRESTSQRHTA
SSLEKQIGHPSPPSEKKELKKAAHLTGKLNSRSMPLEWEDTYGIALVSGVKYKKGSLVIN
ETGLYFVYSKVYFRGQSCNNQPLSHKVYSRNFRYPQDMVLMEGKMMNYCTSGKMWARSSY
LGAVFNLTSADHLYVNVSELSLVSFEESKTFFGLYKL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttgaattacccataccccccaatcttctgggtggacagcagtgccagc
tccccctgggcccctccaggatcagtcttcccctgtccgtcctcagtgccaggaaggccg
gggcaaaggaggccaccaccaccgccacccccaacactaccgccaccgccacccctgcct
ccactaccgccaccacctctgaagaagaggagggaccacaacacaggcctgtgtctcctt
gtgatgtttttcatggttctggtggccctggttggattggggctggggatatttcagctc
ttccatctacagaaggagttggctgaactcagagagtccaccagccaaaggcatacagca
tcatctttggagaagcaaataggtcaccccagtccaccctctgagaaaaaggaactgaaa
aaagcagctcatttaacaggcaagctcaactcaagatccatgcctttggaatgggaagac
acctatggaattgccctggtctctggggtgaagtacaagaagggcagccttgtgatcaat
gaaactgggctatattttgtgtattccaaagtgtacttccggggtcagtcctgcaacaac
cagcccctgagccacaaggtctactccaggaactttaggtacccccaggacatggtgctg
atggaggggaagatgatgaactactgcacttctggcaagatgtgggcccgcagcagctac
ctgggggctgtattcaatctaaccagtgctgaccatttatatgtcaatgtatctgaactc
tctctggtcagttttgaggaatctaagacattttttggcttatataaactctaa

DBGET integrated database retrieval system