KEGG   Bos mutus (wild yak): 102282862Help
Entry
102282862         CDS       T02919                                 

Gene name
PLA2G4D
Definition
(RefSeq) phospholipase A2 group IVD
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00564  Glycerophospholipid metabolism
bom00565  Ether lipid metabolism
bom00590  Arachidonic acid metabolism
bom00591  Linoleic acid metabolism
bom00592  alpha-Linolenic acid metabolism
bom01100  Metabolic pathways
bom04010  MAPK signaling pathway
bom04014  Ras signaling pathway
bom04072  Phospholipase D signaling pathway
bom04217  Necroptosis
bom04270  Vascular smooth muscle contraction
bom04370  VEGF signaling pathway
bom04611  Platelet activation
bom04664  Fc epsilon RI signaling pathway
bom04666  Fc gamma R-mediated phagocytosis
bom04724  Glutamatergic synapse
bom04726  Serotonergic synapse
bom04730  Long-term depression
bom04750  Inflammatory mediator regulation of TRP channels
bom04912  GnRH signaling pathway
bom04913  Ovarian steroidogenesis
bom04921  Oxytocin signaling pathway
bom05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102282862 (PLA2G4D)
   00565 Ether lipid metabolism
    102282862 (PLA2G4D)
   00590 Arachidonic acid metabolism
    102282862 (PLA2G4D)
   00591 Linoleic acid metabolism
    102282862 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    102282862 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102282862 (PLA2G4D)
   04010 MAPK signaling pathway
    102282862 (PLA2G4D)
   04370 VEGF signaling pathway
    102282862 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    102282862 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102282862 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102282862 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    102282862 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    102282862 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102282862 (PLA2G4D)
   04913 Ovarian steroidogenesis
    102282862 (PLA2G4D)
   04921 Oxytocin signaling pathway
    102282862 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102282862 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    102282862 (PLA2G4D)
   04726 Serotonergic synapse
    102282862 (PLA2G4D)
   04730 Long-term depression
    102282862 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102282862 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102282862 (PLA2G4D)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     102282862 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 102282862
NCBI-ProteinID: XP_005904037
Position
Un
AA seq 816 aa AA seqDB search
MERLTPRGPPGHPHQREASTCWRLTVKVLEARGLGWADLLSEADPYVVLQMPTAPGTKFK
TKTVTNSSHPVWNETFTFLIQGQVKNVLELTLYDEDTVTQDDAWFKVLYDVSEVLPGRLL
RKTFSLRTQGPEELDVEFLIEKMSDRPENLITNNVLVARELSRLDVHVVSMAVAADQDEL
ELVLKGSYEDTQTSTLGTASAFCFHYMAAQEAELSGCLRSSISSGWNSGHSAGHLTVPLR
SLAMGKEVTIDVPATNAPGVKLQLKAESCPEELAVHLGFDLSVEERAFLSRRKQVVAKAL
KQVLQLDGDLQEDEVPVIGIMATGGGARAMTSLYGQLLALQKLGLLDCVTYFGGISGSTW
TMAHLYGDPEWSQKDLKGPISHVREHLAKSKLEAFSPECLASYHRELQQRAEQGRTTTFV
DLWGLVLEFMLHGQVVDQKLSGQRAALEQGQNPLPLYLSLSVKENSLQTLDFKEWVEFSP
YEVGFLKYGVFVPPELFGSEFFMGRLMKRLPESRICFLEGIWSNIFSLNLLDAWYDLTSS
DDTWKQHIRDKIRDLGKEPGVSPASAGTSSWPETLWMQPGTALAQMFKGLLTSRPLYQHS
SNFLQGLQMHKDYCAQKDFTTWADCRPDSSPNQLTPQEPQLCLVDAGYFINTSCPVMFRP
GRRLDLIISFDYSLSSPFEVLQQTELDFRARGLPFPRVEPSPKDRRQPRECHLFSDPACP
DAPVVLHFPLVNASFKDHSAPGVQRGPEELSAGQIDLTGVTSPYSTFNMTYKEEDFDRLV
QLSDYNVRSSQDTILQALRTVLKHRAPEARPPRVQT
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atggagagattgacacctaggggaccacctggccatcctcaccagagggaggcctctacc
tgctggcggctcaccgtgaaggtcctggaggcacggggcctgggctgggctgacctgttg
agcgaggcagacccctatgtggtcctacagatgccaaccgcacctggaacgaagtttaag
accaaaacagttaccaactccagtcatcctgtgtggaacgagaccttcactttcctgatc
cagggtcaggtcaagaatgttctggagctgaccctctatgatgaggacacagtcacgcag
gatgacgcctggttcaaggttctctatgatgtctctgaagtcctccctggcaggctgctc
cgaaagaccttctccctgcgcacccagggaccggaggagctggacgtggagttcctgatt
gagaaaatgtcagaccgcccggaaaacctcatcaccaacaacgtgcttgtggcgcgagag
ctgtcacgcctggatgtccatgtcgtcagcatggctgtggctgcagatcaggatgagctg
gagctggtgctgaagggctcgtatgaggacacgcagacatctaccctgggcacagcctct
gccttctgcttccactacatggcagcccaagaggctgagctgagtgggtgcctgaggagc
tctataagcagtggctggaactcaggccactcagctgggcacctcactgtgcccctgagg
tccttggccatggggaaagaggtgaccattgacgtgcctgctacaaacgccccaggagtg
aagctgcagctcaaggctgagagctgccctgaggagctggctgtacatctgggcttcgat
ctgagtgtggaggaaagagccttcctgagcaggaggaagcaggtggtggccaaggccctg
aagcaggtcttgcagctggatggagacctgcaggaagatgaggtccctgtaataggcatc
atggccacaggaggaggcgcccgggccatgacctctctctatggccaactgttggccttg
cagaagctaggccttctggactgtgtgacctacttcggtggcatctcaggctctacatgg
acaatggcccatctgtatggggaccctgagtggtcgcagaaggacctcaaaggacccatc
agtcatgtccgggagcacctggccaagagtaagctggaggccttctctcccgagtgtctg
gcgagctaccatcgggagctgcagcagcgggctgagcagggccgcaccacgacttttgtg
gacctgtggggtctggtgctggagttcatgctgcacggtcaggtggtggatcagaagctg
tcaggacagagagctgcgctggagcagggccagaaccctctgcccctctacttgagcctc
agtgtcaaagagaacagtctgcagaccctggacttcaaggagtgggtcgagttctccccc
tacgaggtcgggttcctgaagtatggagtctttgtccctcctgagctcttcggctctgag
ttcttcatggggcggctgatgaagaggctcccagagtcccggatctgctttctggaaggt
atctggagcaacattttctccctgaacttgctggatgcctggtatgacctcaccagctct
gatgacacctggaagcagcacatccgggacaagatcagggacctgggtaaggagcctgga
gtgtcccctgcctccgcggggacctcctcatggccagagaccttgtggatgcagcctgga
acagcactggcccagatgtttaaaggcctcttgacaagccgaccactctaccagcacagc
tccaacttcctccagggcctccagatgcataaggactactgtgcccagaaagactttacc
acctgggcagactgcaggccagactcctctcccaaccagctgaccccgcaggagccccag
ctctgcctggtggatgctggctacttcattaacaccagctgtcccgtcatgttccggcca
ggccgcaggctggacctcataatctcctttgactactctctatcctcgccctttgaggtg
ctgcagcagacggagctggacttccgggcccgggggctgccattcccccgcgtggagccc
agccccaaggaccgacgccagccccgggagtgccatctcttctcagaccccgcctgcccc
gacgcccctgtcgtgctgcacttcccactggtcaacgcctccttcaaggaccactcggcc
cccggtgtccagcgtgggcctgaagaactctcggccggccagatagatctcactggggtc
acctcaccctattccacgttcaacatgacctacaaggaggaagacttcgaccgcctggtg
cagctcagtgactacaatgtacggagcagccaggacaccatcctgcaggccttgaggacc
gttctgaagcaccgggccccagaggccaggcctccaagggtgcagacttga

DBGET integrated database retrieval system