KEGG   Bos mutus (wild yak): 102283354Help
Entry
102283354         CDS       T02919                                 

Gene name
GMPPA
Definition
(RefSeq) GDP-mannose pyrophosphorylase A
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00051  Fructose and mannose metabolism
bom00520  Amino sugar and nucleotide sugar metabolism
bom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    102283354 (GMPPA)
   00520 Amino sugar and nucleotide sugar metabolism
    102283354 (GMPPA)
Enzymes [BR:bom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     102283354 (GMPPA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase Hexapep NTP_transf_3 DUF4954
Motif
Other DBs
NCBI-GeneID: 102283354
NCBI-ProteinID: XP_005889754
Position
Un
AA seq 420 aa AA seqDB search
MLKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQEILLIGFYQ
PDEPLTRFLEAAQQEFNLPIRYLQEFAPLGTGGGLYHFRDQILAGSPEAFFVLNADVCSD
FPLSAMLDVHRHQPHPFLLLGTTANRTQSLNYGCIVENPQTHEVLHYVEKPSTFVSDIIN
CGIYLFSPEALKPLRDVFQRNQQDGQLEDSSGLWPGAGTIRLEQDVFSALAGQGQIYVHL
TDGIWSQIKSAGSALYASRLYLSQYQLTHPERLAKHTPGGPRIRGNVYIHPTAKVAPSAV
LGPNVSIGEGVTIGEGVRLRESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPNDP
NPNDPRAHMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagctgtgatcctgattggaggccctcaaaaggggactcgcttcaggcctttg
tcatttgaggtgcccaaacccctgtttcctgtggcgggggtgcctatgatccagcaccat
attgaggcttgtgcccaggtccctgggatgcaggagattctgcttattggcttctaccag
cctgatgagccccttacccggttcctggaagctgcccagcaggagttcaaccttcccatc
aggtacctgcaggaatttgcccccctgggcacagggggtggtctctaccatttccgggac
cagatcctggctggaagccctgaagccttcttcgtgctcaacgctgacgtctgctccgac
ttccccttgagcgccatgttggatgtccacagacaccagccacaccctttcttgctcctt
ggcaccacggctaacaggacacagtccctcaactatggctgcattgtggagaatccacag
acgcatgaggtcctgcactatgtggagaagcccagcacattcgtcagtgacatcatcaac
tgcggcatctacctcttttccccagaagccctgaaacccctccgggatgtcttccagcga
aatcagcaggatgggcaactggaggactcttcaggcctatggcccggggcaggtaccatc
cgcctggagcaggacgtattctccgccctggccgggcagggccagatctatgtgcacctc
actgacgggatctggagccagatcaagtccgcaggctcagccctctatgcctcccgcctc
tatctgagccagtaccagctcactcacccagaacgcctggccaagcacacgccagggggt
ccacggattcgaggaaatgtttacatccacccgactgctaaggtggccccatcagcggtg
ttgggccccaacgtctccatcggggagggggtgaccataggtgagggtgtgcggctccga
gagagcatcgtcctccacggagccacactgcaggagcacacgtgtgttctgcacagcatc
gtgggctgggggagcaccgttgggcgctgggcccgtgtggagggtacccccaatgacccc
aatcccaacgacccccgagcccacatggacagtgagagcctgttcaaggacgggaagctg
ctgcctgccatcactatactaggctgccgcgtccggatccctgccgaggtgctcatcctg
aactcgattgttctgccacacaaggagctgagccgcagcttcaccaaccagatcatcctt
tga

DBGET integrated database retrieval system