KEGG   Bos mutus (wild yak): 102283470Help
Entry
102283470         CDS       T02919                                 

Gene name
POR
Definition
(RefSeq) P450 (cytochrome) oxidoreductase
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
bom  Bos mutus (wild yak)
Brite
Enzymes [BR:bom01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102283470 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 102283470
NCBI-ProteinID: XP_005892891
Position
Un
AA seq 681 aa AA seqDB search
MNMADSNMDAGTTTSEMVAEEVSLFSTTDVILFSLIVGVMTYWFLFRKKKEEVPEFTKIQ
TTTSSVKDRSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMAADPEEYD
LADLSSLPEIEKALAIFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFALGNKTY
EHFNAMGKYVDKRLEQLGAQRIFDLGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGE
ESSIRQYELMVHTDMDMAKVYTGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQGTER
HLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGEILGADLDIIMSLNNLDEESNKK
HPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPAEHEQLRKMASSSGEGKELYLR
WVLEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEY
ETKTGRINKGVATSWLRAKEPAGENGGRALVPMYVRKSQFRLPFKATTPVIMVGPGTGVA
PFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAGFHKDGALTQLNVAFSRE
QPQKVYVQHLLKKDKEHLWKLIHEGGCRLPSARRDARNMARDVQNTFYDIVAEQGAMEHA
QAVDYVKKLMTKGRYSLDVWS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggcagactccaacatggatgccggcaccaccacgtctgagatggtggctgaa
gaagtgtcccttttcagcacgacggacgtgatcctgttttctctcatcgtgggtgtcatg
acatactggttcctcttcaggaagaaaaaagaagaagtccccgagttcaccaagattcag
accacgacctcctctgtcaaagacagaagcttcgtggagaagatgaagaagacgggcagg
aacatcatcgtgttctacggctcccagacggggactgctgaggagtttgccaaccgcctg
tccaaggacgcccaccgctatgggatgcggggcatggcagctgaccccgaggagtatgac
ctggccgacctgagcagcctaccagagattgagaaagccctggccatattctgcatggcc
acctacggcgagggggaccccaccgacaatgcccaggacttctacgactggctccaggag
acggacgtggacctctctggggtcaagtacgcggtgtttgcccttgggaacaagacatac
gagcatttcaacgccatgggcaagtacgtggacaagcggctggaacagctcggggcccag
cgaatctttgatctggggctgggcgacgatgacgggaacctggaggaggacttcatcaca
tggcgagagcagttctggccggccgtgtgcgagcacttcggggtggaagccactggagag
gagtccagcattcgccagtacgaactcatggtccacacagacatggacatggccaaggtg
tacacgggcgagatgggccgcctgaagagctacgagaaccagaaaccccccttcgacgcc
aagaacccattcctggctgttgtcaccaccaaccggaagctgaaccagggaaccgagcgg
cacctcatgcacctggaattagacatctcggactccaaaatcaggtatgagtctggggac
catgtggctgtttatccggctaatgactctgccctggtgaaccagcttggcgagatcctg
ggtgccgacttggacatcatcatgtccctgaacaaccttgatgaggagtccaacaagaag
caccccttcccctgccccacctcctaccgcacggccctcacctactacctggacatcacc
aacccgccacgcaccaacgtgctctacgagctggcgcagtacgcctcggagcccgccgag
cacgagcagctgcgcaagatggcctcctcgtcaggcgagggcaaggagctatacctgagg
tgggtgctggaggctcggcggcacatcctggccatcctgcaggactacccgtccctgcgg
ccccccatcgaccacctgtgcgagctgctgcctcgtctccaggcccgctactactccatc
gcctcatcctccaaggtccaccccaactccgtgcacatctgtgccgtggccgtggagtac
gaaaccaagacgggccgcatcaacaagggcgtggccaccagctggttgcgggccaaggag
ccggccggggagaacggtggccgggccctggtgcccatgtacgtgcgcaagtcccagttc
cgcttgcccttcaaggccaccacgcccgttatcatggtgggccccggcaccggggtcgcc
cccttcataggcttcatccaggagcgggcgtggctgaggcagcagggcaaggaggtgggc
gagacgctgctctactacggctgccggcgctctgacgaggactacctgtaccgcgaggag
ctggccggtttccacaaggacggcgccctcacccagctcaacgtggccttctctcgggag
cagccgcagaaggtatacgtgcagcacttactcaagaaggacaaggagcacctgtggaaa
ctcatccacgaggggggctgccgcctcccttctgcgcgcagggacgctcggaacatggcg
agggacgtgcagaacaccttctacgacatcgtggccgagcagggggccatggagcacgcc
caggccgtggactacgtcaagaagctgatgaccaagggccgctactccctggacgtatgg
agctag

DBGET integrated database retrieval system