KEGG   Bos mutus (wild yak): 102285597Help
Entry
102285597         CDS       T02919                                 

Gene name
FBXO17
Definition
(RefSeq) F-box protein 17
  KO
K10101  F-box protein 17
Organism
bom  Bos mutus (wild yak)
Brite
KEGG Orthology (KO) [BR:bom00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bom04121]
    102285597 (FBXO17)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:bom04091]
    102285597 (FBXO17)
Ubiquitin system [BR:bom04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     102285597 (FBXO17)
Lectins [BR:bom04091]
 F-box lectins
  102285597 (FBXO17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBA F-box-like F-box F-box_4
Motif
Other DBs
NCBI-GeneID: 102285597
NCBI-ProteinID: XP_014332119
Position
Un
AA seq 265 aa AA seqDB search
MEPEEVLDLNRLPNELLQEVLSYLPPSTLLQQCRPVCRRWRDVVDGWDLWRSILPWKHPD
LWPVIRTCLPPADDPGPCILGRFCERRPIGRNLLRDSQNACGEEGFRGWEVEHGGNGWAV
EKNLIMMPGAPSQTCFVTSFEWCFKRQLVDLVMEGVWQELLDSAQIEICVADWWGARENC
GCIYRLRVRLLDVYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFGKGIRYVSFEQYGR
DTRSWVGHYGTLVTHSSVRVRIRLS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaacccgaggaggtgttggacctgaaccgactgcctaacgagctgctccaggaggtg
ctgagctacctgcccccaagcacgctgctccagcaatgccgcccagtgtgccggcgctgg
cgagacgtggtggacggctgggacctgtggcggagcatcctgccctggaaacaccccgac
ctgtggcccgtcatccgcacctgcctgccccctgctgacgaccccgggccctgcatcctg
ggccgcttctgcgagcgcagacccataggacgcaacctcctcagggactctcagaatgcc
tgcggtgaagagggcttcagaggctgggaggtggagcacggcgggaatggctgggccgtg
gaaaagaacctcataatgatgccgggcgctccttcccagacctgcttcgtgacttcgttc
gaatggtgctttaagaggcagcttgtggacttggtgatggaaggggtgtggcaggagctg
ctcgacagcgcccaaatcgagatctgtgtggccgactggtggggtgcccgggagaactgc
ggctgcatctaccggcttcgggtccgcctcctggacgtgtatgaaaatgaagtggtcaag
ttctcggcctcacccaacccagtccttcagtggactgaaagaggctgccgacaggtctcc
cacgtctttaccaactttggcaagggtatccgctacgtgtcttttgagcagtatggaaga
gacacgcgttcctgggtggggcactacggcacccttgtgacccactccagtgtgagggtc
aggatccgcctgtcctag

DBGET integrated database retrieval system