KEGG   Bos mutus (wild yak): 102286342Help
Entry
102286342         CDS       T02919                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00561  Glycerolipid metabolism
bom01100  Metabolic pathways
bom04714  Thermogenesis
bom04723  Retrograde endocannabinoid signaling
bom04923  Regulation of lipolysis in adipocytes
Module
bom_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:bom00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102286342 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102286342 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102286342 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102286342 (MGLL)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102286342 (MGLL)
Peptidases [BR:bom01002]
 Serine Peptidases
  Family S33
   102286342 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 Abhydrolase_5 LIDHydrolase BAAT_C Abhydrolase_3 Thioesterase DUF1350 PGAP1
Motif
Other DBs
NCBI-GeneID: 102286342
NCBI-ProteinID: XP_005909458
Position
Un
AA seq 303 aa AA seqDB search
MPEERPPRLTPQNVPYQDLPHLVNADGQHLFCRYWRPLSAPRALVFVSHGAGEHCGRYDE
LAQMLVGLGLLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDAVQKDHPGLPIFLLG
HSMGGAICILTAAERPGHFSGMVLISPLVVANPDSATLLKVFAAKVLNLVLPNMSLGRID
SSVLSRNKTEVDIYNTDPLVCRAGLKVCFGNQLLNAVSRVERALPKLTLPFLLLQGSADR
LCNSRGAYLLMESARSQDKTLKIYEGAYHILHKELPEVTSSVFREINTWVSQRTAVEGTG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggaacgtccccccaggctgaccccgcagaacgttccctaccaggacctccct
cacctggtcaacgctgacgggcagcacctcttctgccggtactggagacccttgagcgcg
cccagggccctggtgttcgtgtcccatggagccggcgagcactgcggccgctacgatgag
ctggcgcagatgctggtggggctgggcctgctggtcttcgcccacgaccacgtcggccac
gggcagagcgagggcgagaggatggtggtgtccgacttccacgtcttcatccgggatgtg
ctccagcacgtggacgccgtgcagaaggaccacccggggctgcccatcttcctccttggc
cactccatgggcggcgcgatctgcatcctcacggccgcggagaggccgggccacttctcg
ggcatggttctcatttccccgctggtcgtcgccaatccagactcggcgacacttctcaag
gtcttcgctgcgaaagttctgaacctcgtcctgccaaacatgtccctgggccggatcgac
tccagtgtgctctcgaggaataagacggaggtggacatctacaacacggaccccctggtc
tgccgcgcggggctcaaagtctgcttcggcaaccagctgctcaacgcggtgtcgcgggtg
gagcgggcgctgcccaagctgacgctgcccttcctgctgctgcagggctctgccgaccgc
ctctgcaacagcaggggcgcctacctgctcatggagtcggccaggagccaggacaagacg
ctcaagatttacgaaggtgcctatcacatcctccacaaagagcttcctgaggtgaccagc
tctgtcttccgggagataaacacgtgggtctcgcaaaggacagcggtggagggaacgggg
tgcccaccctga

DBGET integrated database retrieval system