KEGG   Bos mutus (wild yak): 102286699Help
Entry
102286699         CDS       T02919                                 

Gene name
MTMR7
Definition
(RefSeq) myotubularin related protein 7
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00562  Inositol phosphate metabolism
bom01100  Metabolic pathways
bom04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    102286699 (MTMR7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    102286699 (MTMR7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bom01009]
    102286699 (MTMR7)
Enzymes [BR:bom01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     102286699 (MTMR7)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     102286699 (MTMR7)
Protein phosphatases and associated proteins [BR:bom01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    102286699 (MTMR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related GRAM DSPc Y_phosphatase Y_phosphatase3 DUF5320 CCDC53 FapA
Motif
Other DBs
NCBI-GeneID: 102286699
NCBI-ProteinID: XP_014333385
Position
Un
AA seq 682 aa AA seqDB search
MVEERLCLPVINGEGPVVPWQFKVEYLRTKVENVRLVDRRSSKKAALGTLYLTATHVIFV
EMAPDTRKETWILHSQIATIEKQATTATGCPLLIRCKNFQLLQLIIPQERDCHDVYISLI
RLARPVKYEELYCFSFNPKLDREEREQGWMLIELSEEYKRMGLPNEYWQLSDVNREYRIC
DSYPTELYVPKSATAHIIVGSSKFRSRRRFPALSYYYKDNHASICRSSQPLSGFSARCLE
DEQMLQAIRKANPGSDFLYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHV
MRNSLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHC
SDGWDRTAQVCSVASLLLEPHYRTLKGFMVLIEKDWISFGHKFTHRYGNLDGDPREISPV
IDQFLECVWQLMEQFPCAFEFNERFLIHIQHHIYSCQFGNFLCNSQKERQELKIQDRTYS
LWAHLWKNRADYLNPLFRADHSQTRGVLHLPTAPCNFMYKFWNGMYNRFEKGLQPRQSVT
DYLMAVKEETQQLEEELEALEERLEKIQKVQLNRTKVRSKQSEPSKHSGFSTSDNSAANT
PQDYSGNVKSFPSRSPSQGDEDSALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGG
ECVPSEDSGKDRDSDEAVFLTA
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggagaggctctgcctgcccgtgatcaatggggaaggaccagtggtgccatgg
cagttcaaagtagaatatttaaggacaaaagttgaaaacgtccgcttggtggatcgaaga
tcttctaaaaaagcagccctcgggactttgtatttgaccgccactcacgtcatatttgtg
gaaatggcgcctgacacaaggaaagaaacatggattctccacagtcagatcgccaccatc
gagaaacaggcaacgacggctaccgggtgccctctactgattcgctgcaagaactttcag
ctcttacagctcatcatcccgcaggaaagggactgccatgatgtgtacatctctctcatc
cgcctcgcgagaccagtgaaatatgaggagctgtactgcttttcattcaaccccaagctg
gatagagaagaaagggaacaaggctggatgctgatcgagctcagcgaagaatacaagcgc
atgggcctccctaatgaatattggcagctcagcgacgtgaatagagagtacaggatctgt
gactcctatccgaccgaactgtacgttcccaagtcggccacggcacacatcatagtgggg
agttccaagttccggagcagacggcgatttcctgccctttcttactactataaagataac
cacgcctccatctgccggagcagccagcccctgtctggcttcagtgcccgctgcctggag
gatgagcagatgctgcaggccatcaggaaggccaacccgggaagcgacttcctttatgtt
gtggacactcggcccaagcttaatgcgatggcaaatcgtgctgcagggaaaggctatgag
aacgaagacaattattccaatatcaagtttcagtttatcgggatagagaacatccatgtc
atgaggaacagtctgcagaaaatgctggaagtgtgtgaacttaaatctccctccatgagt
gactttctgtggggactggagaactctggctggttgaggcacattaaggccatcatggat
gcaggaatcttcattgcaaaggcagtttctgaggaaggggccagtgtgcttgtgcactgc
tctgatggctgggacaggaccgctcaggtgtgctcggtggccagcctccttctggaacct
cactaccggactctgaagggcttcatggtattaattgaaaaggactggatttcctttggt
cataagtttactcacagatacggcaacctagatggtgatccccgagaaatctctccagtt
atagaccagttccttgagtgcgtctggcagttaatggaacagtttccctgtgcctttgag
ttcaatgagaggtttttgattcacattcaacatcacatctattcctgccagtttgggaac
ttcctatgtaatagccagaaggagagacaagaactcaaaattcaagacagaacatactct
ttatgggctcacctgtggaaaaatcgggccgactacttgaatcctctgtttagagctgat
cacagtcagacccggggagtccttcatctccccacagcgccgtgcaacttcatgtacaag
ttttggaatggaatgtataatcgctttgagaagggactgcagcctcgacaatcagtcaca
gattacctcatggccgtgaaggaggagactcagcagctggaggaagaacttgaggccctg
gaagaaaggctggaaaaaattcagaaagtgcagttaaatcgcactaaggtgaggagtaag
cagagtgagcccagcaaacactcaggattttctacctcggacaacagcgcagccaacacc
cctcaggattacagtggcaatgtgaagtccttcccatccaggagcccttcccagggcgat
gaggattctgctttgatcctcactcaagacaatctgaaaagttcagacccagacctgtcc
gccaacagtgaccaagagtcgggggtggaggatctgagctgccgctcccccagcggtggg
gagtgtgtgccgagtgaggacagtggcaaggaccgggattccgacgaagccgtgtttctc
actgcctga

DBGET integrated database retrieval system