KEGG   Bos mutus (wild yak): 102287020Help
Entry
102287020         CDS       T02919                                 

Gene name
DDC
Definition
(RefSeq) dopa decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bom  Bos mutus (wild yak)
Pathway
bom00350  Tyrosine metabolism
bom00360  Phenylalanine metabolism
bom00380  Tryptophan metabolism
bom01100  Metabolic pathways
bom04726  Serotonergic synapse
bom04728  Dopaminergic synapse
bom05030  Cocaine addiction
bom05031  Amphetamine addiction
bom05034  Alcoholism
Module
bom_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
bom_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:bom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    102287020 (DDC)
   00360 Phenylalanine metabolism
    102287020 (DDC)
   00380 Tryptophan metabolism
    102287020 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    102287020 (DDC)
   04726 Serotonergic synapse
    102287020 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    102287020 (DDC)
   05031 Amphetamine addiction
    102287020 (DDC)
   05034 Alcoholism
    102287020 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bom04147]
    102287020 (DDC)
Enzymes [BR:bom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     102287020 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     102287020 (DDC)
Exosome [BR:bom04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102287020 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102287020
NCBI-ProteinID: XP_005910027
Position
Un
AA seq 487 aa AA seqDB search
MNASEFRRRGKEMVDYVADYLEGIEGRQVFPDVDPGYLRPLIPTTAPQEPETFEAIIEDV
EKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLQLPEAFLAGEAGEGGGVIQGTASEATLVALLAARTKVTRRLQAASPELTQAAIM
EKLVAYASDQAHSSVEKAGLIGGVRLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVV
ATLGTTSCCSFDNLLEVGPICHKEGLWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKRRTDLTGAFRLDPVYLRHSHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLSHAFEALVRQDTRFEICAEVILGLVCFRLKGSNKLN
EALLESINSAKKIHLVPCSLRDRFVLRFAICSRTVELAHVQLAWEHIQEMAATVLRAQGE
EKAEIKN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaagcgagttccgcaggcgggggaaggaaatggtggattacgtggctgactac
ttggagggcattgaagggcgccaggtgttccctgacgtggatccaggctacctgcgcccc
ctgatccccaccaccgccccgcaggagccagagacatttgaggccatcatcgaggacgtc
gagaagatcatcatgccgggggtgacccactggcacagtccctacttcttcgcctacttc
cccacggccagttcgtacccggccatgctcgcggacatgctgtgtggggccatcggctgc
atcggcttctcctgggctgccagcccggcgtgcacagagctcgagacggtgatgatggac
tggctggggaagatgctgcagctgccagaggcatttctggctggagaagctggagaaggc
ggcggggtgatccagggaactgccagtgaagctaccctggtggccctgctggccgctcgg
accaaagtgacccgacgcctgcaggctgcctccccggagctgacgcaggctgccatcatg
gagaagttggtggcctacgcgtctgaccaggcacactcctccgtggaaaaagccggctta
attggcggagtgagattaaaagccatcccttccgatggcaagtttgccatgcgagcttcc
gcgctgcaggaggccctggagagagacaaggcagccggcctgattcctttcttcgtggtg
gctacactggggaccacgtcctgctgctcctttgacaacctcttagaagtggggcccatt
tgtcacaaggagggcttgtggctgcacgtggacgccgcctacgcaggcagtgccttcatc
tgccctgagttccggcatcttctgaatggcgtggagtttgcagattcatttaactttaat
ccccacaaatggctcttggtgaattttgactgctctgccatgtgggtgaaaaggaggaca
gacctgaccggagccttcaggctggacccagtctatctgaggcacagccaccaggactca
gggcttatcactgactacaggcactggcagctgccgctgggccggaggttccgctctttg
aagatgtggtttgtttttaggatgtacggagtcaagggactgcaggcctatatccgcaag
catgtccagctgtcccatgcattcgaggcattggtgcgccaggacacccgctttgaaatc
tgtgcagaagtcattctgggactggtctgtttccggctaaagggttccaacaaactgaac
gaagctcttctggaaagcataaacagtgccaaaaaaatccacttggtcccttgttccctg
agagaccggttcgtgctgcgcttcgccatctgctcacgcacagtggagctggcccacgta
cagctggcctgggagcacatccaggagatggcggccacagtgttaagagcacagggggag
gaaaaggcagagatcaaaaattga

DBGET integrated database retrieval system