KEGG   Bos mutus (wild yak): 102288183Help
Entry
102288183         CDS       T02919                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 1-like
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
bom  Bos mutus (wild yak)
Pathway
bom03410  Base excision repair
bom04210  Apoptosis
bom04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:bom00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102288183
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102288183
   04217 Necroptosis
    102288183
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bom03032]
    102288183
   03036 Chromosome and associated proteins [BR:bom03036]
    102288183
   03400 DNA repair and recombination proteins [BR:bom03400]
    102288183
Enzymes [BR:bom01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     102288183
DNA replication proteins [BR:bom03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102288183
Chromosome and associated proteins [BR:bom03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102288183
DNA repair and recombination proteins [BR:bom03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     102288183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-PARP DUF809
Motif
Other DBs
NCBI-GeneID: 102288183
NCBI-ProteinID: XP_005893451
Position
Un
AA seq 239 aa AA seqDB search
MAESSDKLYRVEYAKSGRASCKKCKESIPKDSIRMAFMVQSPMFDGKIPHWYHLSCFWKV
GFSIWHPDVEVEGFSELRWDDQQTIKKMAETGGATGKGQDGVGSKTEKTLIDFGAGYAKS
NRSTCKSCMEKIDKGQVRLSKKVVYPDKPQLGMVDCWYHPKCFVQKREELGFRPEFSASQ
LMGFSVLTAEDQETLKKQLPAIKGERKRKGDEVDGIDEVTKKKSKKEKDKEIKLEKALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcttcagacaagctctaccgggtcgagtacgccaagagcgggcgcgcgtct
tgcaagaaatgcaaagagagcatccccaaggactcgatccggatggccttcatggtgcag
tcgcccatgttcgatgggaaaatcccgcactggtaccacctctcctgcttctggaaggtc
ggcttctccatctggcaccctgatgtcgaggtggaggggttctctgagctccgctgggat
gaccagcagacgatcaagaagatggccgagactggcggagcgacaggcaaaggccaagat
ggagttggcagcaagaccgagaagacactgattgactttggggcagggtacgccaagtcc
aacagaagcacgtgcaagagctgcatggagaagatagacaagggccaggtgcgcctgtct
aaaaaggtggtgtaccccgataagccccagctgggcatggttgactgctggtaccaccca
aagtgttttgttcagaaacgggaggagctgggcttccgtcccgagttcagcgcaagccag
ctcatgggcttcagcgtcctcaccgcagaggaccaagaaaccctcaagaagcagctcccg
gccatcaagggtgaaagaaagagaaaaggtgatgaggtggatggaatagatgaagtgacc
aagaagaaatctaaaaaagaaaaagacaaggagattaaacttgaaaaggcccttaag

DBGET integrated database retrieval system