KEGG   Bos mutus (wild yak): 106701470
Entry
106701470         CDS       T02919                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
bom  Bos mutus (wild yak)
Pathway
bom04080  Neuroactive ligand-receptor interaction
bom04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:bom00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106701470 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106701470 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 106701470
NCBI-ProteinID: XP_014337873
Position
Un
AA seq 136 aa
MAQEQRESQQDRAAESILAASRSTSEMPGITSDRIRASATSMAFSRAISAAIFTVQGRTQ
RLLKVPTEDNIEVGQESQATERPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRRK
FRRQRPRLSHKGPMPF
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccaagagcaaagggagagccagcaggacagagctgcagagagcatcctggccgcc
tcgcgcagtaccagtgagatgccaggcatcacctctgacaggattcgagcttctgccact
tctatggctttctccagggccattagtgcagccatcttcacagtgcaagggagaacgcag
cggctcctcaaggtgccaactgaggacaacatcgaggtggggcaggagtctcaagccact
gagcgacccctgctgcagacttctgacgggaaggagatggaagaaggcaccatccgatac
ctggtgcagcccagggggccgaggagcggcccaggcccctggcagggaggtcggaggaag
ttccggcgccagcggccacgcctctcccacaagggtcccatgcctttctga

DBGET integrated database retrieval system