KEGG   Bacillus oceanisediminis: A361_01030Help
Entry
A361_01030        CDS       T04330                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00220  Arginine biosynthesis
bon00330  Arginine and proline metabolism
bon01100  Metabolic pathways
bon01110  Biosynthesis of secondary metabolites
bon01130  Biosynthesis of antibiotics
bon01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    A361_01030
   00330 Arginine and proline metabolism
    A361_01030
Enzymes [BR:bon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     A361_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AND37801
UniProt: A0A161JB05
Position
179183..180088
Genome map
AA seq 301 aa AA seqDB search
MKRQKLSIIGMPMDLGQMRRGVDMGPSAIRYAGVNERLKCLFEEIHDQGDIAIGRPEVQI
DPKSNLRNLDLIAEKTEKLGEEVDKAIESGSFPLVLGGDHSIAIGTLAGVSKHYKNLGVI
WYDAHGDLNTAETSPSGNIHGMPLAVSLGIGHPLLTNVGGYAPKVKPENIVIIGARSLDE
GERELIKEKGIKVYTMHEIDRLGMTKVMEESITYLKERNTDGVHLSLDLDGLDPHDAPGV
GTPVIGGISYRESHLAMEMLAESQIITSAEFVEVNPILDDKNKTATVAVALMGSLFGEKL
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacagaaattatcgataattggaatgccaatggatcttggccagatgagacgc
ggtgtggacatggggccaagtgcgatccgatatgccggtgtgaatgagcgattaaagtgt
ttattcgaagaaatccatgaccagggcgatattgccatcggccgtccggaagttcaaatc
gatccaaaatcaaatcttagaaacttggaccttattgctgaaaaaacagaaaaactgggc
gaagaagttgataaagcaatagaaagtggttcttttccattagtactgggcggggatcac
agcatcgcaattggaacattggccggtgtttcgaagcactacaaaaatcttggggtaatc
tggtatgatgcccacggggatttaaatacagctgaaacatcaccttcagggaacatacat
ggcatgcctcttgcggtaagcctgggaattggccacccgcttttaaccaatgtaggggga
tatgctccaaaggttaagccagagaatattgtcattattggggcaagatctttggatgaa
ggagagcgggagcttattaaggaaaaaggcattaaagtatacaccatgcacgaaattgac
cggcttgggatgacaaaggttatggaggagtctattacatatttaaaagaaagaaataca
gatggtgttcatctgtctctggatttagatgggctggatccgcatgatgcccctggtgtt
ggaactccggttattggaggcatcagctaccgtgaaagccacttggccatggagatgctt
gcagaatcgcagatcattacatcggctgagtttgtagaggttaacccaatcctggatgac
aaaaacaaaacagctactgtggcggtcgcgcttatgggttcactatttggcgagaagctt
ctataa

DBGET integrated database retrieval system