KEGG   Bacillus oceanisediminis: A361_01315Help
Entry
A361_01315        CDS       T04330                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00860  Porphyrin and chlorophyll metabolism
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A361_01315
Enzymes [BR:bon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     A361_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 AAA_26 CbiA DUF1611 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AND37857
UniProt: A0A160M633
Position
245541..247064
Genome map
AA seq 507 aa AA seqDB search
MKGIMIQGTSSDAGKSLIATALCRAFSNEGFRTAPFKSQNMSNNSYVTKDGNEIGRAQGI
QAEAARTEAAVWMNPILLKPQSAQNAEVILLGKAVNSLSGRSYRESFYEKGLETIREALS
LLDAQYELLVIEGAGSPVEINLKDKELVNMKVAEMADVPVILVADIDRGGVFASIVGTLE
LFTKQERQRVAGIIINKFRGDITLFEDGIRWIEERTGIPVLGVLPYLDDHMIDAEDSLSI
QAAVPRAGGGILDIAVLRPPFISNFSDIDPFYYEDDVNIRWVRHLSEAGSPDAVIIPGTK
STIRDLRYFKEKGLADWIVRYAADGGSIAGICGGYQMLGRRLIDMAGSDTGNPNEKEKGL
NLIPADTIFHERKKTVQVKGSLHSSTNLPVKEILDGYEIHLGETVLEEDFDGNRLLLLQN
GEEDGFYGNEGRLVGTYMHHIFHNDEWRGEWLNSLRKQKGIPSKEPVRIKALKDRKYNEL
AENMIQHLDWGKLKEIVFSWRKQNEMA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggataatgattcagggaacttcatccgatgcagggaaaagcctgattgctacg
gctctttgccgggcattctccaatgaaggtttccgtacggctccttttaaatcccagaat
atgtccaataattcatacgtgacaaaggatggaaatgaaatcggcagggcacagggcatt
caggctgaagcggcaagaactgaagctgctgtctggatgaatcctattctccttaagcct
caatccgcacagaatgcggaggtcattctccttggaaaagcagtcaattccctatcagga
agaagctatcgggaatccttttatgaaaagggactggagaccatcagagaggcactgagt
ctgcttgatgctcaatacgaactgcttgtgatagagggggctggcagccctgttgaaatt
aatttaaaagataaagagcttgttaatatgaaagtagccgaaatggcggatgtgcctgtc
atcctggttgccgatattgacaggggcggtgtttttgccagcattgtcggaaccctggag
cttttcaccaaacaggaaagacagcgggttgcgggcattatcattaataaattccgcgga
gatatcacgctgtttgaggatggcatccgctggatcgaggaaaggacgggcattcctgtc
ctcggggttcttccttatttggatgaccatatgatcgatgcagaggattccctatccatt
caggctgctgttccaagggctggaggaggcattctggacattgcagtgcttcggccgcca
tttatttcaaacttcagtgacattgatccgttttactatgaagatgacgtgaacattaga
tgggtaaggcatctatcggaagctggctcacctgatgcggtgatcattcccggcacaaag
agcacgattcgcgatttgcgctatttcaaggaaaaaggtctggcggactggattgtgcgc
tatgctgccgatggaggttctattgccggcatttgtggaggataccagatgctcggcagg
agattaatcgatatggcaggttctgataccgggaaccctaatgaaaaggaaaaaggcttg
aatttgataccggcagataccatttttcatgaacgcaagaagacggtgcaggtgaagggc
agtttgcattcaagcacgaaccttcccgtaaaggaaatcttggatggatatgaaatccat
ttaggtgaaacagttcttgaagaagactttgatggcaatcgccttcttctgcttcaaaat
ggcgaagaagatggattctatggaaatgaaggccgtctggtagggacgtatatgcaccac
atcttccataatgatgaatggaggggtgagtggcttaattccctgcgcaaacaaaaaggc
attccaagtaaggagcctgtccgaataaaagccctgaaggataggaaatacaacgaactg
gcggaaaatatgattcagcatcttgattggggaaaattgaaggaaatcgtctttagctgg
agaaaacagaatgaaatggcttaa

DBGET integrated database retrieval system