KEGG   Bacillus oceanisediminis: A361_01950Help
Entry
A361_01950        CDS       T04330                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00250  Alanine, aspartate and glutamate metabolism
bon00330  Arginine and proline metabolism
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A361_01950
   00330 Arginine and proline metabolism
    A361_01950
Enzymes [BR:bon01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     A361_01950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AND37957
UniProt: A0A160M6B9
Position
370779..372326
Genome map
AA seq 515 aa AA seqDB search
MVQPYKHEPFTNFKEEENREAYLKGLQTVESYLGQDYDLLIGGERISTEDKIVSINPSNK
EEVVGRVSKANRELAEKAMQAAVEAFKTWRKVKPETRADVLFKAAAIIRRRKHEFSALLT
KEAGKPWNEADADTAEAIDFLEYYARQILKIKDGVPVNSRPNEYNRYDYIPLGVGIIISP
WNFPLAIMAGTTVAAIVAGNTVLLKPASTTPVVAAKFVEVMEEAGLPKGVLNFVPGSGAE
VGDYLVDHKDTRFISFTGSRDVGLRINERASKLNEGQIWLKRVIAEMGGKDTIVVDKEAD
LELAATSIVASAFGFSGQKCSACSRAVVVEDVYDQVLNRVVELTNELTQGNPEDQSNYMG
PVIDQGAFDKIMSYIEIGKEEGKLMTGGEGDSSKGFFIKPTVFADLAPDARLMQEEIFGP
VVGFTKAKDFDHALEIANNTEYGLTGAVITQNREHIQKAREDFHVGNLYFNRGCTGAIVG
YQPFGGFNMSGTDSKAGGPDYILLHMQAKTTSEMY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaccttataagcatgagccattcacgaattttaaagaagaagaaaatcgtgaa
gcatatttaaagggtttacaaactgtagaaagctatttgggccaggattatgatctttta
attggcggagagcgcatttctactgaagataaaattgtatcaatcaatccttctaataaa
gaagaagtagttggccgtgtttcaaaggcaaaccgcgagcttgcggaaaaagcaatgcag
gctgctgttgaagcattcaaaacatggagaaaagtgaagccggaaacacgcgcagatgtt
ttattcaaagctgctgcgatcatccgccgccgtaagcatgagttttctgcccttttaaca
aaggaagcagggaagccttggaacgaggcagatgctgatactgcggaagccattgacttc
cttgagtactatgcacgccaaatcttaaaaatcaaagacggtgttccagtcaacagccgt
ccgaacgaatataaccgttatgactacattccattgggagtggggatcatcatctctcct
tggaacttcccgcttgcaatcatggccggcactactgttgccgcgatcgtggcaggaaat
acagtcctattaaaaccagcttctacaacaccggttgtggctgcgaaatttgttgaagtg
atggaagaggcaggccttccgaagggcgtgctgaactttgtaccgggcagcggtgcagaa
gtgggcgactatttggttgaccataaagacactcgcttcatctccttcacgggttcacgc
gacgttggtcttcgcatcaacgaacgtgcttccaagctaaacgaaggccaaatctggcta
aagcgtgtgatcgctgaaatgggtggtaaggacacaatcgttgtggacaaagaagcagac
cttgaattggcagctacttcaatcgttgcctctgctttcggattctccggccagaagtgc
tctgcatgttcacgtgcggttgtagtagaagatgtatacgatcaggttcttaaccgtgtg
gtggaactgactaacgaattaacgcagggcaatcctgaagaccagagcaattacatgggt
ccagtgattgatcagggcgcatttgataaaattatgagctacatcgaaatcggcaaagaa
gaaggcaagctgatgacgggcggagaaggagacagctcgaaaggcttcttcatcaagccg
acagtattcgcagaccttgccccggatgcacgcttaatgcaggaagagatctttggacct
gtcgttggcttcacaaaggcaaaagatttcgatcatgcgcttgaaatcgccaacaacacc
gagtacggcttaacaggtgctgtgatcacacagaaccgtgagcacatccaaaaagcgcgc
gaagacttccatgttggaaacttatacttcaaccgcggctgtacaggcgcgattgttgga
taccagccattcggcggattcaacatgtcaggaactgactccaaggcgggcggccctgac
tacattcttctgcatatgcaggcgaagactacttctgaaatgtattaa

DBGET integrated database retrieval system