KEGG   Bacillus oceanisediminis: A361_01980Help
Entry
A361_01980        CDS       T04330                                 

Definition
(GenBank) asparaginyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00970  Aminoacyl-tRNA biosynthesis
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A361_01980
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bon03029]
    A361_01980
Enzymes [BR:bon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A361_01980
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A361_01980
Mitochondrial biogenesis [BR:bon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A361_01980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln Cohesin_load HNH_4 C9orf72-like
Motif
Other DBs
NCBI-ProteinID: AND37963
UniProt: A0A160M6Z8
Position
377976..378266
Genome map
AA seq 96 aa AA seqDB search
MSRISIDQVKHVAHLARLAMTEEEAVAYTEQLDKMISFAELLNELDTDHVEPTSHVLDMK
NVLREDKANKGLPQEEVLKNAPEHQDGYIKVPSIIE
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaatttcaatagatcaggttaagcatgttgcacacctggcgcgacttgcaatg
actgaggaagaagctgttgcatacaccgaacagctggacaagatgatttcatttgccgaa
ctgctgaatgagcttgatacagaccatgttgaaccaacatcccatgttcttgatatgaag
aatgtattgagagaagataaggcaaataaggggcttccacaggaagaagttctgaaaaat
gcgccggaacatcaggatggctatataaaagtgccgtctattattgaatag

DBGET integrated database retrieval system