KEGG   Bacillus oceanisediminis: A361_01985Help
Entry
A361_01985        CDS       T04330                                 

Gene name
gatA
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bon  Bacillus oceanisediminis
Pathway
bon00970  Aminoacyl-tRNA biosynthesis
bon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bon00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A361_01985 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bon03029]
    A361_01985 (gatA)
Enzymes [BR:bon01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A361_01985 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A361_01985 (gatA)
Mitochondrial biogenesis [BR:bon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A361_01985 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AND42686
UniProt: A0A160MH37
Position
378280..379737
Genome map
AA seq 485 aa AA seqDB search
MSLFDHKVSELHQLLHKKEITVTDLVSESYKRIGEVEDKVQAFLTLDEEKAREAAKRMDG
KIGTDEAKGLLFGMPIGVKDNIVTKGLRTTSASKILENFDPIYDATAASKLHNAETITIG
KLNMDEFAMGSSNENSGFQVTRNPWNLERVPGGSSGGSAASVAAGEVLFSLGSDTGGSIR
QPASYCGVVGLKPTYGRVSRFGLIAFASSLDQIGPITRTVEDNAYLLQAISGVDPMDSTS
ANVEVPSYAESLTGDVKGLRIAVPKEYLAEGVNEEVRQSVLDALKVLEKLGATWEEVSLP
HSKYALATYYLLSSSEASANLARFDGVRYGYRTADPENLIDLYKKTRAEGFGDEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKQDFENVFEKYDVIIGPTAPTPAFKIGENTSDPLT
MYANDILTIPVNLAGVPGISVPCGFADGLPLGLQIIGKHFDESTVYRVAHAFEQATEFHK
QKPGL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttatttgaccataaggtatcggaacttcatcagcttttacataagaaagaaatc
acggttaccgaccttgtcagcgaatcgtacaagcgaatcggtgaagttgaagataaagta
caggctttcttgacgcttgatgaagaaaaagcccgtgaagcagctaaaagaatggatggg
aaaattggaacagacgaggcaaaaggccttttgttcggtatgccaatcggcgtgaaggat
aacatcgtaacgaaggggctgcgcaccaccagtgcgagtaaaatccttgaaaactttgat
ccgatttatgatgcgactgctgcatccaaattacataatgctgaaaccattacaatcggt
aaactgaatatggatgaatttgcaatgggatcatccaatgaaaactcaggctttcaagta
acccgaaacccatggaatctagaaagagttcccggaggatcttccggtggttctgctgct
tctgttgcagccggtgaagttttattttctcttggatcagacacaggcggctcaatcaga
cagcctgcttcttattgcggagttgttgggttaaagcctacatatggaagagtatcaaga
ttcggactgatcgcgtttgcctcatctctggaccaaatcgggccaattacacggaccgtt
gaagataacgcatatctgcttcaggcaatttcaggtgtggatcctatggattctacttca
gcaaatgttgaggtcccaagctatgcggaaagcttgactggggatgtaaaggggctgaga
attgccgtaccgaaagagtatttggctgaaggtgtgaatgaagaggtgcgccagtcagta
ctggacgccctgaaagtgttagaaaaacttggggcaacatgggaggaagtttccctgccg
cattcgaaatatgcactggcaacgtattatctgctgtcctcctctgaggcatcggcaaac
ctggcacgctttgatggcgtacgctatggctatagaacagcagatcctgagaatttaatc
gatttatacaaaaagacccgtgcagaaggctttggtgatgaagtgaaacgccgcatcatg
cttggcacattcgccttaagttcaggctattatgatgcttactataaaaaggcacaaaag
gtgcgtacactgattaaacaagactttgaaaatgtttttgaaaaatatgatgtcattatt
ggaccgacagcaccaactcctgcctttaagattggtgaaaatacatctgatccgctgaca
atgtacgcaaatgatattctgacaattccagtaaaccttgccggcgtacctggaatcagc
gtaccttgcggattcgcggatggattgccgcttggccttcagattatcggaaagcatttt
gatgaaagcactgtttaccgcgtagcgcatgcttttgagcaggctacagaattccataag
caaaaaccgggactgtaa

DBGET integrated database retrieval system